(data stored in ACNUC1104 zone)

EMBL: BX640427.ILVG

BX640427.ILVG        Location/Qualifiers
FT   CDS_pept        complement(282928..284661)
FT                   /transl_table=11
FT                   /gene="ilvG"
FT                   /locus_tag="BPP1571"
FT                   /product="acetolactate synthase large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1860"
FT                   /db_xref="GOA:Q7WA22"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA22"
FT                   /protein_id="CAE36873.1"
FT                   /translation="MTTPALPERNGGQILMQQLRVHGARRVFMIPGESYLPCIDALNEH
FT                   RGAIDAIVCRQESGAAYMAEAYGKLTGEPGICFVTRGPGATNASIGVHTAYQDSTPMIL
FT                   FIGQVGNDFMEREAFQEIDYRRMFGQMAKWVAQIDRTERIPEFIARAFAVATSGRPGPV
FT                   VLALPEDTLWGRARVADMPRYRRARCLPGAADLARMVELLDQAERPFMLLGGTGWSAEA
FT                   IGQAAAFAERFELPVGTAWRRLECFDQRHPNAAGHVGWAMAPELRQRIAGADLVLAVGT
FT                   RMGEATTEGYTVIESPLPRQRLVHAYPDPNELGRVFAPTLGIVADPAGFAAALDALRPG
FT                   HRASRAQAVRAAHDEYLATLAPLPSPGPLNLDSAAAYVNQHIPADACITVGAGNYALYP
FT                   HRYRQFSGPGTSLAPTVGSMGYGLPAAISAKLENPARTVVCYAGDGCFQMNMQELGVAL
FT                   LQELGVALQYRVGVVVLVFNNGIWGTIRAHQEREFPGRAIALDFQNPDFTQFVRAYGGY
FT                   GEAVERTEDFGPAFERARAFAEREQLPALLEIRYEADGIAPGQTLTEIHQAAQAQAAGV
FT                   Q"
     atgaccacgc cagccctgcc cgagcgcaac ggcggccaga tcctgatgca gcagctgcgc        60
     gtgcacggcg cgcggcgcgt gttcatgatt cccggcgaga gctacctgcc ctgcatcgac       120
     gccctgaacg agcatcgcgg cgccatcgac gccattgtct gccgccagga aagcggcgcg       180
     gcctacatgg ccgaggccta tggcaagctg accggcgagc cggggatctg cttcgtcacc       240
     cgcggccccg gcgccaccaa cgccagcatc ggcgtgcata cggcctacca ggactcgacc       300
     ccgatgattc tgttcatcgg ccaggtcggc aacgacttca tggagcgcga ggcgttccag       360
     gaaatcgact accgccgcat gttcggccag atggccaagt gggtcgcgca gatcgaccgc       420
     accgagcgga ttcccgaatt catcgcgcgc gccttcgcgg tggccaccag cggccggccc       480
     gggccggtgg tgctggcgct gcccgaggac acgctgtggg gccgcgcccg cgtggccgac       540
     atgccgcgct accggcgcgc gcgctgcctg cccggcgcgg ccgacctggc gcgcatggtc       600
     gaattgctgg accaggccga gcggcccttc atgctgctgg gcggcacagg ctggagcgcc       660
     gaggccatcg gacaggccgc cgcgttcgcc gaacgcttcg agctgccggt aggcacggcc       720
     tggcgccgcc tggaatgctt cgaccagcgc catcccaatg ccgccggcca cgtcggctgg       780
     gccatggcgc cggaactgcg ccagcgcatc gccggcgcgg acctggtcct ggcggtgggc       840
     acgcgcatgg gcgaggccac caccgaaggc tacaccgtga tcgagagccc gctgccgcgc       900
     cagcggctgg tgcacgccta ccccgacccc aacgaactgg gccgggtgtt cgcgccgacc       960
     ctgggcatcg tggccgaccc ggccgggttc gcggccgcgc tcgacgcgct gcggccggga      1020
     caccgcgcca gccgcgcgca ggccgtgcgc gccgcgcacg acgaatacct ggccacgctg      1080
     gccccgctgc cctcgcccgg cccgctcaac ctcgacagcg ccgccgccta cgtcaaccag      1140
     cacatcccgg ccgacgcctg catcacggtg ggcgcgggca attacgccct gtacccgcac      1200
     cgctaccgcc agttcagcgg cccgggcacc agcctggcgc ccacggtcgg ctcgatgggc      1260
     tacggcctgc cggcggccat ttcggccaag ctggaaaacc ccgcccgcac cgtggtctgc      1320
     tacgccggcg acggctgctt ccagatgaac atgcaggaac tcggcgtggc gctgctgcag      1380
     gaactcggcg tggcgctgca ataccgcgtc ggcgtggtcg tgctggtgtt caacaatggc      1440
     atctggggta ccatccgcgc ccaccaggaa cgcgaattcc cgggccgcgc cattgccctg      1500
     gacttccaga atcccgattt cacccaattc gtgcgcgcct acggcggcta cggcgaagcg      1560
     gtcgagcgca ccgaggactt cggcccggcc ttcgagcgcg cgcgcgcctt cgccgaacgc      1620
     gagcaattgc cggcgctatt ggaaatccgc tacgaagccg acggcatcgc gccgggccag      1680
     accctgacgg aaatccacca ggcggcccag gcccaggccg ccggcgtgca atga            1734
//

If you have problems or comments...

PBIL Back to PBIL home page