(data stored in ACNUC1104 zone)

EMBL: BX640427.LPXA

BX640427.LPXA        Location/Qualifiers
FT   CDS_pept        252618..253412
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="BPP1539"
FT                   /product="acyl-[acyl-carrier-protein]--UDP-N-acetylglucos
FT                   amine O-acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1431"
FT                   /db_xref="GOA:Q7WA48"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA48"
FT                   /protein_id="CAE36841.1"
FT                   /translation="MSGNIHPTAVVDPAAQIDSSVVIGPYSVVGPGVSIAAGTEVGAHC
FT                   VLDGVTSIGRDNRFYRFCSIGGMPQDKKYSGEPTRLVIGDRNTVREFTTFNTGTVQDGG
FT                   VTSIGDDNWIMAYVHIAHDCHIGNNTILANSVQLGGHVQVGDWAIVGGLTGVHQFAKIG
FT                   AHSMTGSNSSLMQDAPPFVLAAGNPCRPVGVNVEGLKRRGFSAAAISALRDAYKSIYRR
FT                   GLSLDEARAELRARQQAEPDVAEHLQTMLDFLDASTRGIIRP"
     atgtcaggaa acatccatcc caccgccgtg gtcgatccgg cggcacagat cgacagttcg        60
     gtcgtgatcg gcccatacag cgtggtgggg ccgggagtca gcattgccgc gggcaccgag       120
     gtcggcgcgc actgcgtgct cgacggcgtg accagcatcg ggcgcgacaa ccgcttctac       180
     cgcttttgct ccatcggcgg catgccgcag gacaagaagt acagcggcga accgacgcga       240
     ctggtcatcg gcgaccgcaa cacggtgcgc gagttcacca cgttcaacac cggcacggtg       300
     caggacggcg gcgtgaccag catcggcgac gacaactgga tcatggccta cgtgcacatc       360
     gcgcacgact gccatatcgg caacaacacc atcctggcca actcggtgca gctgggcggc       420
     cacgtgcagg tgggcgactg ggccatcgtg ggcggcctga ccggcgtgca ccagttcgcc       480
     aagatcggcg cgcacagcat gaccggcagc aacagctcgc tgatgcagga tgcgcccccg       540
     ttcgtgctgg cggcgggcaa tccgtgccgg cccgtgggcg tcaatgtcga aggcttgaag       600
     cggcgcggtt tctcggcggc ggccatctcg gcgctgcgcg atgcgtacaa gtcgatctac       660
     cggcgcggac tgtcgctgga cgaggcgcgc gccgagctgc gcgcgcgcca gcaggccgag       720
     ccggatgtcg ccgagcatct gcagaccatg ctggacttcc tggacgcttc gacgcgcggc       780
     atcatccggc catga                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page