(data stored in ACNUC1104 zone)

EMBL: BX640427.MOTA

BX640427.MOTA        Location/Qualifiers
FT   CDS_pept        181843..182718
FT                   /transl_table=11
FT                   /gene="motA"
FT                   /locus_tag="BPP1469"
FT                   /product="chemotaxis protein MotA"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1024"
FT                   /db_xref="GOA:Q7WAB1"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAB1"
FT                   /protein_id="CAE36771.1"
FT                   /translation="MLIVIGYAVVILAVVGSFIGLGGHLGALYQPFELTLIAGAAVGAF
FT                   MAGNSRKSLGLVAKAIPEAFRSSPYSKDVYMELMALLYVLLNKARREGLMAIESHIEDP
FT                   LSSPIFNEYPRIMKDAKLMEFITDYLRIMISGNMSSFEIETLMDEEIETYRHEREVPTH
FT                   ALQQVADALPAFGIVAAVLGVIKALAAVDQPPAILGDLISKAMVGTFLGVLLAYGFVAP
FT                   MAARIERRTSESVKVLECIKVTLLASMNGYPPQLAVEFGRKVLFSAVRPSFGELEEHVR
FT                   QAKSAATGRA"
     gtgttgattg ttatcggtta tgcagtggtc atcctggcgg tggtcggcag tttcatcggc        60
     ctgggcggcc atctgggcgc gctctaccag cctttcgagc tgacgctgat cgccggcgcg       120
     gccgtgggcg ccttcatggc gggcaacagc cgcaagtcgc tcggcctggt cgccaaggcg       180
     atcccggagg cgtttcgcag ctcgccctac agcaaggacg tgtacatgga gctgatggcg       240
     cttctgtacg tgctgctgaa caaggcgcgc cgcgaagggc tgatggccat cgaatcgcac       300
     atcgaggatc cgctgtccag cccgatcttc aatgagtatc cgcgcatcat gaaggatgcc       360
     aagctgatgg agttcatcac ggactacctg cgcatcatga tcagcggcaa catgagctcg       420
     ttcgagatcg aaacgctgat ggacgaggag atcgagacct accggcacga gcgcgaagtg       480
     cccacccatg cgctgcagca ggtggccgac gccttgccgg ccttcggcat cgtggccgcc       540
     gtgctgggcg tgatcaaggc gctggcggcg gtggaccagc cgccggcgat cctgggcgac       600
     ctgatctcca aggccatggt cggcaccttc ctgggcgtgc tgctggccta cggtttcgtg       660
     gcgccgatgg ccgcccgcat cgaacggcgc acctctgaat cggtcaaggt gctcgaatgc       720
     atcaaggtga cgttgctggc cagcatgaac ggctatccgc cccaactggc ggtggagttc       780
     ggccgcaagg tgctgttctc ggcggtgcgc ccctcgttcg gcgagctgga agagcatgtg       840
     cgccaggcca agagcgcggc caccggccgc gcctga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page