(data stored in ACNUC1104 zone)

EMBL: BX640427.MOTB

BX640427.MOTB        Location/Qualifiers
FT   CDS_pept        182731..183678
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="BPP1470"
FT                   /product="chemotaxis protein MotB"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1025"
FT                   /db_xref="GOA:Q7WAB0"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAB0"
FT                   /protein_id="CAE36772.1"
FT                   /translation="MSTVNNHRVVIRRRKVRRGGHHGGSWKIAYADFITAMMAFFLVMW
FT                   LISIVPREELKGIAEYFRMPLRVALTGGPSSSAETSAIPGGGQDPLRSQGDVRRAEGNR
FT                   VEAQPMGDAERRDRHRLERLKVRLENLIEESPVLKNFRPQLLIDMTTEGLRIQIVDNQN
FT                   RPMFATGSADVQPYMRDILRELGPVLNDLPNKISIAGHTDASQYARGERAYSNWELSAD
FT                   RANASRQELVAGGMHEGKVLRIQGLASSMSLVKDDPFAAVNRRISLVVLNASTQRRIEN
FT                   ENAAAADVNARDAQGVGAALAGQLAASGSDGGAR"
     atgagcacgg tcaacaatca ccgtgtggtg atccggcgcc gcaaggtgcg ccgcggcgga        60
     caccacggcg gcagctggaa gatcgcctac gccgacttca tcacggccat gatggcgttc       120
     ttcctcgtca tgtggctgat cagcatcgtg ccgcgcgaag aactcaaggg catcgccgag       180
     tatttccgca tgcccctgcg ggtggccctg accggcggcc ccagcagctc ggccgagacc       240
     agcgcgatcc ccggcggcgg gcaggacccg ctgcgcagcc agggcgacgt gcggcgcgcc       300
     gagggcaacc gggtcgaggc ccagcccatg ggcgacgccg agcggcgcga ccgccatcgc       360
     ctggaacgcc tgaaggtccg cctggagaac ctgatcgagg aaagcccggt cctgaagaat       420
     ttccggccgc agctgctgat cgacatgacg accgagggct tgcgcatcca gatcgtcgac       480
     aaccagaacc gccccatgtt cgccaccggc agcgccgacg tgcagccgta catgcgcgac       540
     atcctgcgcg agctggggcc ggtgctcaac gacctgccca acaagatcag catcgccggc       600
     cataccgacg cgtcgcagta cgcgcgcggc gagcgcgcct acagcaattg ggagctgtcg       660
     gccgaccgcg ccaacgcgtc gcgccaggag ctggtggccg gcggcatgca cgagggcaag       720
     gtgttgcgca tccagggcct ggcctcgagc atgagcctgg ttaaagatga cccgtttgct       780
     gccgttaaca gacgtatcag tctggtggtg ctcaatgcat cgacccagcg gcgcatcgag       840
     aacgagaacg ccgcggcggc cgatgtcaac gcgcgcgacg cgcagggcgt cggcgcggcg       900
     ctggccggcc agttggcggc cagcggctcg gacgggggcg ccaggtag                    948
//

If you have problems or comments...

PBIL Back to PBIL home page