(data stored in ACNUC1104 zone)

EMBL: BX640427.PE10

BX640427.PE10        Location/Qualifiers
FT   CDS_pept        9927..10451
FT                   /transl_table=11
FT                   /locus_tag="BPP1301"
FT                   /product="putative DNA-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2589"
FT                   /db_xref="GOA:Q7WAR8"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAR8"
FT                   /protein_id="CAE36603.1"
FT                   /translation="MEYLFTLKYQLADADSDLDPLVERLGQAGCDDALVGMGLPGRLAL
FT                   EFTREADSAEAAVRSALADVRRAMPTAALIEAAPDLVGLTDVAQIVGVSRQNMRKLMLA
FT                   HPATFPAPIHEGSASLWHLADVLGWLQARGGYPLAQATLDVARMALKVNVAKEARRLPR
FT                   SAGAGLDALVG"
     atggaatacc tcttcaccct caaataccag ctggccgacg ccgacagcga cctggacccc        60
     ttggtcgagc gtctgggcca ggccggttgc gacgacgccc tggtgggcat gggcctgccc       120
     ggccgcctgg cgctcgaatt cacccgcgag gccgacagcg ccgaggcggc cgtgcgcagc       180
     gcgctggccg acgtgcgccg cgccatgccc acggcggcgc tgatcgaggc cgcgcccgac       240
     ctggtcggcc tgaccgacgt ggcgcagatc gtcggcgtgt cgcggcagaa catgcgcaag       300
     ctgatgctgg cgcaccccgc cacctttccg gcgcccatcc acgagggcag cgcctcgctg       360
     tggcacctgg ccgacgtgct gggctggctg caggcccgcg gcggctatcc gctggcgcag       420
     gccacgctgg atgtggcgcg catggcgctg aaggtcaatg tggccaagga ggcgcggcgc       480
     ctgccgcgct cggccggcgc cggcctcgac gccctggtgg gatga                       525
//

If you have problems or comments...

PBIL Back to PBIL home page