(data stored in ACNUC1104 zone)

EMBL: BX640427.PE102

BX640427.PE102       Location/Qualifiers
FT   CDS_pept        complement(100588..101361)
FT                   /transl_table=11
FT                   /locus_tag="BPP1393"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to Salmonella typhi putative lipoprotein
FT                   Sty0979 SWALL:Q8Z804 (EMBL:AL627268) (253 aa) fasta scores:
FT                   E(): 3.5e-46, 53.3% id in 257 aa, and to Pseudomonas
FT                   aeruginosa hypothetical protein Pa0277 SWALL:Q9I6L3
FT                   (EMBL:AE004465) (252 aa) fasta scores: E(): 2.3e-50, 55.85%
FT                   id in 256 aa"
FT                   /db_xref="GOA:Q7WAI4"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAI4"
FT                   /protein_id="CAE36695.1"
FT                   /translation="MMKSKTKLLGGALAASLLLAGCASMKSMDTNSLLSAGSDMAKAAN
FT                   LSDADIIQLSDAACKQSDQESKIAPAGNKYSVRLTKLMRGFGNMTLNGQKVNYKVYMTE
FT                   DVNAWAMGNGCVRVYTGLMDLMNDDELRGVIGHEMGHVALGHTKKAMQTAYAVSAARQA
FT                   AGAAGNSVVASLSASQLGEMTEKFINAQFSQSQETAADDFSFDLLTEKKMNRKGLVTAF
FT                   QKLAELDGGESSMFSSHPSSPDRAARMEKRLQAGK"
     atgatgaaga gcaagacgaa actgctcggc ggcgccctgg ccgccagcct gctgctggcc        60
     ggctgcgcca gcatgaagag catggacacc aacagcctgc tttcggcggg ctccgacatg       120
     gccaaggcgg ccaatctttc cgacgccgac atcatccagc tgtcggacgc cgcctgcaag       180
     caaagcgacc aggaatcgaa gatcgccccg gccggcaaca agtacagcgt gcgcctgacc       240
     aagctgatgc gcggcttcgg caacatgacg ctcaacggac agaaggtcaa ctacaaggtc       300
     tacatgaccg aggacgtcaa cgcctgggcc atgggcaacg gttgcgtgcg cgtctacacc       360
     ggcctgatgg acctgatgaa cgacgacgag ctgcgcggcg tgatcggcca tgaaatgggc       420
     cacgtcgcgc tgggccacac caagaaggcc atgcagaccg cctacgcggt cagcgccgcg       480
     cgccaggccg ccggcgccgc cggcaacagc gtggtggctt cgctgagcgc ttcgcaactg       540
     ggcgagatga ccgagaaatt catcaacgcg cagttctcgc agtcgcagga aaccgccgca       600
     gacgacttct cgttcgacct gctcaccgag aagaagatga accgcaaggg cctggtgacg       660
     gccttccaga agctggccga gctcgacggc ggcgagagca gcatgttcag ctcgcacccg       720
     tcctcgccgg accgcgcggc gcgcatggaa aagcgcctgc aagccggcaa gtaa             774
//

If you have problems or comments...

PBIL Back to PBIL home page