(data stored in ACNUC1104 zone)

EMBL: BX640427.PE104

BX640427.PE104       Location/Qualifiers
FT   CDS_pept        102185..103378
FT                   /transl_table=11
FT                   /locus_tag="BPP1395"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Ralstonia solanacearum probable multidrug
FT                   transport transmembrane protein Rsp0429 or Rs00888
FT                   SWALL:Q8XSN8 (EMBL:AL646078) (399 aa) fasta scores: E():
FT                   3.8e-84, 60.93% id in 384 aa, and to Rhizobium loti
FT                   hypothetical protein Mlr8412 SWALL:Q983A8 (EMBL:AP003014)
FT                   (405 aa) fasta scores: E(): 1e-54, 43.52% id in 386 aa"
FT                   /db_xref="GOA:Q7WAI2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAI2"
FT                   /protein_id="CAE36697.1"
FT                   /translation="MPSRSAQSSSNVLRLAAAQALAGANTTVVYATAAIIGEALAPSKS
FT                   LATLPISVFVVGMAASTLPAGAVAQRHGRRAAFMLGTLCGVLLGLLAALGIYLESFALF
FT                   CAAMAFGGAYAAVVLTFRFAAAECVEPHRKARALSTVLAGGVLAGVLGPQLVSYTMDAW
FT                   SGHVFAGTYLAASAVAVLAAVVLGGVDLPRPARAAAAGGRPLRVIARQPRFIAAVVCGV
FT                   VTYMLMNFLMTSAPLAMRMHGLSQHASNLGVQWHVIAMYAPSFVAGGLITRHGAVPVVA
FT                   AGLLLTAAAAVVGLAGMDAWHFWVSLTLLGVGWNFGFAGASAMVLECHLPQERTRVQAA
FT                   NDFIIFGTMVVGSFVSGDLLMRYGWEVVCWLALPPLAVAAFALRWFKPLPAGAAGRA"
     atgccgtccc gttccgcgca gtcctcctcc aacgttctgc ggcttgccgc ggcacaggcg        60
     ctggccggcg ccaacacgac cgtggtgtac gccaccgccg ccatcatcgg cgaggcgctc       120
     gcgccgtcca aatcgctggc gacgctgccg atttcggtat tcgtggtggg catggccgcc       180
     agcacgctgc cggccggcgc cgtggcgcaa cgccacggcc ggcgcgcggc gttcatgctg       240
     ggcacgctgt gcggcgtgct gctcggcctg ctggccgcgc tgggcatcta cctggaatcg       300
     ttcgcgctgt tctgcgccgc catggccttc ggcggcgcct atgccgccgt ggtgctgacg       360
     ttccgctttg ccgccgccga gtgcgtcgaa ccgcaccgca aggcccgggc cctgtcgacc       420
     gtgctggccg gcggcgtgct ggccggcgtg ctcggcccgc aactggtgtc ctacaccatg       480
     gacgcctgga gcggccatgt tttcgccggc acgtacctgg cggcttcggc ggtggcggtg       540
     ctggccgccg tggtgctggg cggcgtcgac ctgccgcggc cggcgcgcgc cgccgccgcg       600
     ggcggacggc ccctgcgggt catcgcgcgc cagccgcgct tcatcgcggc ggtggtgtgc       660
     ggcgtggtga cctacatgct gatgaatttc ctcatgacgt cggcgcccct ggcgatgcgc       720
     atgcatggcc tgtcgcagca cgcctccaac ctgggcgtgc aatggcacgt catcgcgatg       780
     tacgcgccca gcttcgtggc cggcgggctg atcacccgcc acggcgcggt gccggtggtc       840
     gcggccggcc tgctgctgac cgcggccgcg gccgtggtcg gcctggcggg catggacgca       900
     tggcatttct gggtgtcgct gacgctgctg ggcgtgggct ggaatttcgg cttcgccggc       960
     gcgtcggcca tggtgctgga atgccatctg ccgcaagagc gcacgcgggt gcaggccgcc      1020
     aacgatttca tcatcttcgg caccatggtg gtgggctcgt tcgtctcggg cgatctgctg      1080
     atgcgctacg gctgggaagt cgtgtgctgg ctggcgctgc cgccgctggc cgtggccgcg      1140
     ttcgcgctgc gctggttcaa gccgctgccg gccggcgccg cgggcagagc ctag            1194
//

If you have problems or comments...

PBIL Back to PBIL home page