(data stored in ACNUC1104 zone)

EMBL: BX640427.PE105

BX640427.PE105       Location/Qualifiers
FT   CDS_pept        complement(103385..104296)
FT                   /transl_table=11
FT                   /locus_tag="BPP1396"
FT                   /product="probable LysR-family transcriptional regulator"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   transcriptional regulator Pa2469 SWALL:Q9I113
FT                   (EMBL:AE004674) (304 aa) fasta scores: E(): 2.3e-38, 38.25%
FT                   id in 298 aa, and to Salmonella typhimurium, and Salmonella
FT                   typhi putative transcriptional regulator, LysR family
FT                   Stm2180 or Sty2410 SWALL:Q8XG81 (EMBL:AE008797) (302 aa)
FT                   fasta scores: E(): 1.2e-33, 37.74% id in 302 aa"
FT                   /db_xref="GOA:Q7WAI1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037405"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAI1"
FT                   /protein_id="CAE36698.1"
FT                   /translation="MLTNWIDRLRPRHLRLLIRLCETGNLTEVAIEYGISQPALSKWLK
FT                   DLEADIGQRLFVREPRGVTPTACARELQAHARAIIGRLERARTAVDHIASGFAGHLSVG
FT                   FSPVVGPVVLPESIRRFRAAYPDVLVSVIEASIDLLLPGLRNGDFDIVVGRLEEVAMPE
FT                   DVRCETLYDEPVCLVAGRAHPLAGRRRISWEDAQAYPWISPQQGTPLRMRLEMELAVAG
FT                   QPLPRHAVESTSVQTNVALLDRSDMIAPMSRRLAEHFQRQGVLRILPLTLGSGGPIGML
FT                   WRADGVHGTHTAHFIACLRQAV"
     atgctcacga actggatcga ccggctgcgg ccccgccacc tgcgcctgct gatacgcctg        60
     tgcgaaaccg gcaacctgac cgaagtggcc atcgaatacg gcatcagcca gcccgcgctg       120
     tcgaaatggc tcaaggacct cgaggccgac atcggccagc gcctgttcgt gcgcgagccg       180
     cgcggcgtga cgccgacggc ctgcgcgcgc gaactgcagg cgcacgcgcg cgccatcatc       240
     ggccggctcg aacgcgcccg taccgcggta gaccacatcg caagcggttt cgcgggccat       300
     ctgtcggtgg gtttctcgcc ggtggtgggg ccggtcgtgc tgcccgaaag catccggcgc       360
     tttcgcgccg cctatccgga cgtgctggtc agcgtgatcg aagcctcgat cgatctgctg       420
     ctgccgggcc tgcgcaacgg ggatttcgat atcgtcgtcg ggcgcctgga agaggttgcc       480
     atgcccgagg atgtccgctg cgagacgctg tacgacgaac cggtctgcct ggtggcgggc       540
     cgcgcgcatc cgctggccgg ccgccggcgc atcagctggg aggacgcgca ggcctatccg       600
     tggatctcgc cgcaacaggg cacgccgctg cgcatgcggc tggaaatgga actcgccgtg       660
     gccggccagc ccctgccgcg ccatgcggtg gagtcgacct cggtgcagac caacgtcgcc       720
     ctgctcgacc gctcggacat gatcgcgccc atgtcgcgcc ggctggccga gcacttccag       780
     cgccagggcg tgctgcgcat cctgccgctg acgctgggca gcggcggccc catcggcatg       840
     ctgtggcggg ccgacggcgt gcatggcacc catacggccc atttcatcgc ctgcctgcgc       900
     caggcggtgt ga                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page