(data stored in ACNUC1104 zone)

EMBL: BX640427.PE108

BX640427.PE108       Location/Qualifiers
FT   CDS_pept        complement(107049..107561)
FT                   /transl_table=11
FT                   /locus_tag="BPP1399"
FT                   /product="putative membrane protein"
FT                   /note="no significant database matches"
FT                   /db_xref="GOA:Q7WAH8"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAH8"
FT                   /protein_id="CAE36701.1"
FT                   /translation="MMRHERLRFWLAGLAAAATGWLCYAGLARLAGALGVATWIPYPAL
FT                   RRQWLLIGESWQSAEFSGAIADASVFLTALAAVAAYYCARIVYHLSFAPVRQRRARWLI
FT                   AGWIVGTVAMVALSQSLGWLYGAFPGFARIGWLSAALGFAVLAGAASGFARAWGRLMRA
FT                   RKVPATE"
     atgatgcgcc atgaacgcct gcgcttctgg ctggccggcc tggcggcggc ggccaccggc        60
     tggctgtgct acgccggcct ggcgcggctg gcgggcgcgc tgggcgtggc gacctggatt       120
     ccctatccgg cgctgcgccg ccagtggctg ctgatcggcg agagctggca atcggccgaa       180
     ttcagcggcg ccatcgccga cgcgtcggtt ttcctgacgg cgctggcggc cgtggccgcg       240
     tattactgcg cgcgcatcgt gtaccacctc agtttcgcgc cggtccgcca gcgccgggcg       300
     cgctggctga ttgccggctg gatcgtcggc acggtcgcca tggtcgcgct gtcgcaaagc       360
     ctgggctggc tgtacggcgc gtttcccggt ttcgcgcgca tcggctggct gtcggccgcg       420
     ctgggctttg ccgtgctggc cggcgcggcc agcggctttg cgcgcgcatg gggccggctg       480
     atgcgcgccc gcaaggtgcc tgccacggag tga                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page