(data stored in ACNUC1104 zone)

EMBL: BX640427.PE109

BX640427.PE109       Location/Qualifiers
FT   CDS_pept        108060..109565
FT                   /transl_table=11
FT                   /locus_tag="BPP1400"
FT                   /product="probable membrane protein"
FT                   /note="Similar to Ralstonia solanacearum probable
FT                   transmembrane protein Rsc0793 or Rs05044 SWALL:Q8Y197
FT                   (EMBL:AL646061) (500 aa) fasta scores: E(): 4.1e-134, 72.2%
FT                   id in 500 aa, and to Agrobacterium tumefaciens hypothetical
FT                   protein Atu0118 or Agr_c_184 SWALL:Q8UJ20 (EMBL:AE008986)
FT                   (501 aa) fasta scores: E(): 3.6e-122, 65.46% id in 501 aa"
FT                   /db_xref="GOA:Q7WAH7"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAH7"
FT                   /protein_id="CAE36702.1"
FT                   /translation="MELLQNLALGFSVAFTPENLLYALLGCVLGTLVGVLPGLGPVPTI
FT                   AMLLPITYVLPPVAGLIMLAGIYYGTQYGGATTAILVNLPGETSAVVTVLDGHQMARNG
FT                   RAGAALALAAIGSFFAGTVATMLIAAFAPPLAEVAFKFGPAEYFSLMVLGLIGAVVLAS
FT                   GSILKAVAMIILGLLLGMVGTDVNSGVARYDFGIPELQDGIDFAIVAMGVFGFAEILTN
FT                   LEQKENRVDITDKVGSLYPNKQEMREAAPAIVRGTALGSCLGILPGGGSVLSAFASYSL
FT                   EKKLSRNPERFGKGHPAGLAGPESANNAGAQTSFIPLLTLGIPGNAVMALMVGAMTIHN
FT                   IQPGPQVMTSHPELFWGLIASMWIGNLMLVVLNLPLVGLWVKLLKVPYRILYPAILVFC
FT                   TIGVYSLNYNVFDVFVTAIFGVVGYVWSKLKCEGAPLLLGLVLGPMMEENFRRALLLSR
FT                   GDFLTFVERPLSASLLGAAALLVIIVALPSIRKKRDETFVEEE"
     atggaactgc tgcaaaatct ggcgcttggc ttttcggtag cgttcacgcc ggaaaacctg        60
     ttgtacgcgc tgctgggctg cgtgctgggc accctggtcg gcgtgctgcc cggcctgggg       120
     ccggtgccca ccatcgccat gctgctgccc atcacctatg tgctgccgcc ggtggccggc       180
     ctgatcatgc tggccggcat ctactacggc acgcagtacg ggggggcgac cacggccatc       240
     ctggtcaacc tgcccggcga gacatcggcg gtggtgaccg tgctcgatgg ccaccagatg       300
     gcgcgcaacg gccgcgccgg cgcggcgctg gcgctggcgg ccatcggttc gttcttcgcc       360
     ggcactgtcg ccaccatgct gatcgccgcc ttcgcgccgc cgctggccga agtcgccttc       420
     aagttcggcc cggccgaata tttctcgctc atggtgctgg gcctgatcgg cgccgtggtg       480
     ctggcgtcgg gctccatcct caaggcggtg gccatgatca tcctcggcct gctgctgggc       540
     atggtcggca ccgacgtgaa ctccggcgtg gcccgctacg acttcggcat ccccgagctg       600
     caggacggca tcgacttcgc catcgtcgcc atgggcgtgt tcggcttcgc cgaaatcctc       660
     accaacctgg aacagaagga aaaccgcgtc gacatcaccg acaaggtcgg ttcgctgtat       720
     ccgaacaagc aggaaatgcg cgaagccgcg ccggccatcg tgcgcggcac cgcgctgggg       780
     tcgtgcctgg gcatcctgcc gggcggcggc tcggtgctgt cggccttcgc ctcgtactcg       840
     ctggaaaaga agctgtcgcg caatcccgag cgcttcggca agggccatcc ggccggcctg       900
     gccggccccg aatcggccaa caacgccggc gcgcagacct cgttcatccc gctgctgacc       960
     ctgggcatcc cgggcaacgc cgtgatggcg ctgatggtcg gcgcgatgac catccacaac      1020
     atccagccgg gtccgcaggt catgaccagc caccccgagc tgttctgggg cctgatcgcc      1080
     tcgatgtgga tcggcaacct gatgctggtg gtgctgaacc tgccgctggt cggcctgtgg      1140
     gtcaagctgc tcaaggtccc gtaccgcatc ctgtacccgg ccatcctggt gttctgcacc      1200
     atcggcgtgt actcgctgaa ctacaacgtc ttcgacgtgt tcgtcaccgc catcttcggc      1260
     gtggtgggct atgtatggtc caagctgaaa tgcgagggcg cgccgctgct gctgggcctg      1320
     gtgctcggcc ccatgatgga agagaacttc cggcgcgcgc tgctgctgtc gcgcggcgac      1380
     ttcctgacct tcgtcgagcg gccgctgtcg gcctcgctgc tgggtgcggc ggccctgctg      1440
     gtgatcatcg tggcgctgcc gtcgatccgc aagaagcgcg acgagacctt cgtcgaagaa      1500
     gaatga                                                                 1506
//

If you have problems or comments...

PBIL Back to PBIL home page