(data stored in ACNUC1104 zone)

EMBL: BX640427.PE110

BX640427.PE110       Location/Qualifiers
FT   CDS_pept        complement(109663..110127)
FT                   /transl_table=11
FT                   /locus_tag="BPP1401"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Rhizobium loti probable transcriptional
FT                   regulator Mlr1478 SWALL:Q98KH0 (EMBL:AP002997) (148 aa)
FT                   fasta scores: E(): 1.8e-17, 47.79% id in 136 aa, and to
FT                   Brucella melitensis transcriptional regulator, MarR family
FT                   Bmeii0520 SWALL:Q8YCK8 (EMBL:AE009688) (145 aa) fasta
FT                   scores: E(): 8.8e-16, 49.58% id in 121 aa"
FT                   /db_xref="GOA:Q7WAH6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAH6"
FT                   /protein_id="CAE36703.1"
FT                   /translation="MSDVQTSSPSPAPPRGRKLDKADFAALADLRYALRRFMAFSEAAA
FT                   TESGLTAQQHQALLAIKASDDTLSVGELADRLLIRHHSAGELVDRLARMDMVRRIPSNA
FT                   DRRRVLVALTPLAEHTLDTLSAAHVEELRSVGPLLRTLLSYFDSPAYRRK"
     atgtcagacg tccagacctc ttcccccagc cccgcgccgc cacgcggccg caagctggat        60
     aaagccgatt ttgccgccct ggcggacctg cgctacgcgc tgcgccgctt catggccttc       120
     agcgaagccg cggccaccga aagcggcctg accgcgcagc aacaccaggc cctgctggcc       180
     atcaaggcat cggacgacac gctgagcgta ggcgaactgg ccgaccggct gctgatccgc       240
     catcacagcg ccggcgaact ggtcgaccgg ctcgcgcgca tggatatggt gcggcgcatt       300
     cccagcaacg ccgaccgccg ccgcgtgctg gtggccctga ccccgctggc cgagcacacg       360
     ctggatacgc tgtcggccgc gcacgtcgag gaactgcgct cggtcggacc gctgctgcgt       420
     acgctgctga gctatttcga ttcgccggcg tatcggcgca agtaa                       465
//

If you have problems or comments...

PBIL Back to PBIL home page