(data stored in ACNUC1104 zone)

EMBL: BX640427.PE113

BX640427.PE113       Location/Qualifiers
FT   CDS_pept        complement(110972..111814)
FT                   /transl_table=11
FT                   /locus_tag="BPP1404"
FT                   /product="putative AraC-family transcriptional regulator"
FT                   /note="Similar to Xylella fastidiosa transcriptional
FT                   regulator Xf1254 SWALL:Q9PDX5 (EMBL:AE003959) (280 aa)
FT                   fasta scores: E(): 5.5e-44, 45.98% id in 274 aa, and to
FT                   Agrobacterium tumefaciens transcriptional regulator, AraC
FT                   family Atu4575 or Agr_l_593 SWALL:Q8U779 (EMBL:AE009385)
FT                   (321 aa) fasta scores: E(): 4.1e-15, 31.37% id in 290 aa"
FT                   /db_xref="GOA:Q7WAH3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAH3"
FT                   /protein_id="CAE36706.1"
FT                   /translation="MDRLSALLERFRVRTALLHAGTLCGHHRFEAQPGRAFLHVLRRGD
FT                   MEVRHRPGETALPRLRLAEPTLLFYPRPLHHEFINPPAEGPDLTCATLDFEGGDRHPLV
FT                   RSLPPVVCVPLDAVAGLRPALDLLFAEADQVRCGSRVLADRLFEVVLIQLLRWMLDHPA
FT                   QVGVSNGLIMGLSDPRLAKALAALHGAPGQAWPLTRMADIAGMSRSAFAAAFKTATGVT
FT                   PAAYLADWRLSLAASMLRAGHPMKRIAPELGFAGVPALSKAFRQRMGASARQWLDAQR"
     gtggacaggc tgtcggccct gctggaacgc ttccgcgttc gcaccgccct gctccacgcc        60
     ggcacgctgt gcggccacca ccgcttcgag gcgcagcccg ggcgcgcctt cctgcacgta       120
     ttgcgccgcg gcgatatgga agtgcgccac cgcccgggcg aaaccgcgct gccgcgcctg       180
     cggctggccg agcccactct gctgttctac ccgcgtccct tgcatcacga gttcatcaac       240
     ccgcccgccg aggggcccga cttgacctgc gccacgctgg atttcgaagg cggcgaccgt       300
     catccgctgg tgcgctcgct gccgccggtc gtctgcgtgc cgctggacgc ggtggccggc       360
     ctgcggcccg cgctggacct gctgttcgcc gaggccgatc aggtgcgttg cggttcgcgc       420
     gtcctggccg accgcctgtt cgaggtcgtg ctgatccagc tgctgcgctg gatgctcgac       480
     cacccggccc aggtcggcgt gagcaacgga ctgatcatgg gcctgtcgga cccgcgcctg       540
     gccaaggccc tggcggcgtt gcacggcgct ccaggccagg cctggccgtt gacgcggatg       600
     gcggatatcg cgggcatgtc gcgcagcgcc tttgccgcgg cgttcaagac ggcgacgggg       660
     gtcacgcccg cggcctacct ggccgattgg cggctgagcc tggcggcgtc catgctgcgc       720
     gccggccacc ccatgaagcg catcgcgccc gagctgggct ttgccggcgt gccggcgctg       780
     tccaaggcct tccggcagcg gatgggcgct tcggcgcgcc agtggctgga cgcccagcgc       840
     tga                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page