(data stored in ACNUC1104 zone)

EMBL: BX640427.PE116

BX640427.PE116       Location/Qualifiers
FT   CDS_pept        113095..113382
FT                   /transl_table=11
FT                   /locus_tag="BPP1407"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Streptomyces coelicolor hypothetical 7.8
FT                   kDa protein Sc10f4.38C SWALL:Q9F3M3 (EMBL:AL450350) (69 aa)
FT                   fasta scores: E(): 5.2e-13, 57.81% id in 64 aa, and to
FT                   Streptomyces coelicolor hypothetical 9.9 kDa protein
FT                   Scf43a.35C SWALL:Q9XA80 (EMBL:AL096837) (88 aa) fasta
FT                   scores: E(): 0.00075, 29.07% id in 86 aa"
FT                   /db_xref="InterPro:IPR021331"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAH0"
FT                   /protein_id="CAE36709.1"
FT                   /translation="MREARPRAGRAFATGGDGMTGKTAFRIGDHVAWNSEAGQVSGTII
FT                   AIHTRDFDYKGHTHRASPDHPQYEIKSDKTDHIAAHRGEVLRRVRAKGGA"
     atgcgggagg cccggccgcg cgccggccgg gcgttcgcga caggaggcga tggcatgacc        60
     ggcaagacgg cattcaggat cggcgaccac gtggcctgga actccgaggc cggccaggtg       120
     tcgggcacca tcatcgccat ccacacgcgg gacttcgatt acaaggggca cacgcatcgc       180
     gcctcgcccg accatccgca gtacgaaatc aagagcgaca agaccgatca catcgccgcg       240
     caccgcggcg aggtgctgcg gcgcgtgcgc gcaaagggcg gggcatga                    288
//

If you have problems or comments...

PBIL Back to PBIL home page