(data stored in ACNUC1104 zone)

EMBL: BX640427.PE118

BX640427.PE118       Location/Qualifiers
FT   CDS_pept        114017..115063
FT                   /transl_table=11
FT                   /locus_tag="BPP1409"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Zymomonas mobilis hypothetical 36.5 kDa
FT                   protein SWALL:Q9RH20 (EMBL:AF088897) (322 aa) fasta scores:
FT                   E(): 2.1e-70, 57.84% id in 306 aa, and to Mycobacterium
FT                   tuberculosis hypothetical protein Rv0799c or Mtcy07h7a.10
FT                   or Mtci429b.01 or Mt0820 SWALL:O07180 (EMBL:Z96797) (335
FT                   aa) fasta scores: E(): 6.9e-70, 56.56% id in 343 aa"
FT                   /db_xref="GOA:Q7WAG8"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAG8"
FT                   /protein_id="CAE36711.1"
FT                   /translation="MPQNNPEPQAVVSPITRSAIFLVATVGADNEAADKVRALCGKLAD
FT                   LARAVGKRVPAGNLSCVCGFSAAGWDRLFGQPRPAELHPFREFSAGERRAPATPGDLLL
FT                   HIRAEQMDLCFELATHVMAQLGDAVTVVDEVHGFRYFDLRSMVGFVDGTENPTGREALD
FT                   FTLVDDADPDFAGGSYVLVQKYLHDMDGWNALSVETQERIIGRTKLSDIELDEAVKPSN
FT                   SHSALTTLEENGQEIKILRDNMPFGRPGSGEFGTYFIGYARSPAPIEQMLENMVVGRPP
FT                   GNYDRLLDFSRAVTGGLFFAPSADLLEALAERDPQDTDGSRLDPAPAARAPHDGSLNIG
FT                   SLKGNPQQ"
     atgcctcaga acaatccgga accacaggcc gtcgtcagtc cgatcacacg cagcgccatt        60
     ttcctcgtcg ccactgtcgg cgccgacaac gaagccgccg acaaggtccg cgccctgtgc       120
     ggcaagctgg ccgacctggc gcgcgccgtc ggcaagcggg tgccggccgg caatctttcc       180
     tgtgtatgcg gtttcagcgc cgcgggctgg gaccgcctgt tcggccagcc gcggccggcc       240
     gagctgcacc cctttcgcga attcagcgcc ggcgagcgcc gcgctccggc caccccgggc       300
     gacctgctgc tgcacatccg cgccgagcag atggacctct gtttcgagct ggccacccat       360
     gtgatggcgc agctgggcga cgccgtcacc gtggtcgacg aagtgcacgg ctttcgctat       420
     ttcgacctgc gcagcatggt cggcttcgtc gacggcaccg aaaaccccac cgggcgcgaa       480
     gcgctggatt tcaccctggt ggacgacgcc gatccggatt tcgccggcgg cagctacgtc       540
     ctggtgcaga aatatctgca cgacatggat ggctggaacg cgctgtccgt cgagacccag       600
     gagcgcatca tcgggcgcac caagctgtcg gacatcgaac tggacgaggc cgtcaagccc       660
     agcaactcgc acagcgccct gaccacgctc gaagaaaacg gccaggaaat caagatcctg       720
     cgcgacaaca tgccgtttgg ccggcccggc tccggcgagt tcggcaccta tttcatcggc       780
     tatgcccgct cgcccgcgcc catcgagcaa atgctcgaga acatggtcgt gggacgcccg       840
     ccgggcaact atgaccgcct gctcgacttc agccgcgcgg tgaccggcgg cctgttcttc       900
     gcgccttcgg ccgacctgct cgaagcgctg gccgaacgcg acccgcaaga caccgacggc       960
     agccggcttg accccgcgcc ggccgcgcgc gcgccgcatg acggctcgct gaacattggc      1020
     tccctgaaag gaaaccccca gcaatga                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page