(data stored in ACNUC1104 zone)

EMBL: BX640427.PE12

BX640427.PE12        Location/Qualifiers
FT   CDS_pept        11002..11496
FT                   /transl_table=11
FT                   /locus_tag="BPP1303"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Brucella melitensis hypothetical membrane
FT                   spanning protein Bmeii0616 SWALL:Q8YCB6 (EMBL:AE009697)
FT                   (162 aa) fasta scores: E(): 8.1e-18, 39.1% id in 156 aa,
FT                   and to Rhizobium loti hypothetical protein Mll7507
FT                   SWALL:Q985V9 (EMBL:AP003012) (167 aa) fasta scores: E():
FT                   1.7e-17, 39.49% id in 157 aa"
FT                   /db_xref="GOA:Q7WAR6"
FT                   /db_xref="InterPro:IPR021329"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAR6"
FT                   /protein_id="CAE36605.1"
FT                   /translation="MAPQEMLARVVLVGMGATAVMDVWTMALRRLGVPVLDYALAGRWA
FT                   GHWRHGRFAHADIRQAPAVRGEAALGWGLHYATGVLFAGLLVGVAGQAWLRAPSPGPAL
FT                   AVGVATVLLPWFVMQPALGAGLASSRTPTPLRNCLRSVLVHAVFGLGLYLAGLALAWIG
FT                   R"
     atggcaccgc aggagatgct ggcgcgcgtc gtgctggtcg gcatgggcgc cacggccgtg        60
     atggacgtgt ggacgatggc actcaggcgc ctgggcgtgc ccgtgctgga ctatgccctg       120
     gcgggccgct gggcgggcca ctggcgccat ggccggtttg cgcacgccga tatccggcag       180
     gcgccggcgg tgcgcggcga agcggcgttg ggttgggggc tgcactatgc gaccggcgtg       240
     ctgttcgccg gcctgctggt cggcgtcgcg ggccaggcat ggctgcgggc gccgtcgccg       300
     gggccggcct tggcggtggg cgtggcgacc gtgctgttgc cgtggttcgt gatgcagccc       360
     gcgctgggag cgggactcgc ttcgtcgcgc acgcccacgc cgctcaggaa ttgcctgcgc       420
     agcgtgcttg tgcacgcggt ctttggcctg gggctttatc tggccggcct ggcgctggcc       480
     tggatagggc gctga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page