(data stored in ACNUC1104 zone)

EMBL: BX640427.PE121

BX640427.PE121       Location/Qualifiers
FT   CDS_pept        complement(117220..117741)
FT                   /transl_table=11
FT                   /locus_tag="BPP1412"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Klebsiella pneumoniae putative small
FT                   integral C4-dicarboxylate membrane transport protein DctQ
FT                   dctQ SWALL:Q9RN75 (EMBL:AF186091) (136 aa) fasta scores:
FT                   E(): 1.3e-05, 26.89% id in 119 aa"
FT                   /db_xref="GOA:Q7WAG5"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAG5"
FT                   /protein_id="CAE36714.1"
FT                   /translation="MKSLLDRLTRIGHGTNRAAVFIAQAALLLMMLLTVYSVIARYVLQ
FT                   QPSVHAVEISIYLLLLVTWLSVGWTHLLERHVSMEMLSIRVRGRGKRLLNVFRELVVLV
FT                   FCGFLLHAGVQIAATALARNYRSTSLLAFPMWIAYGLIAVGALLLAIAAACKLNHPDGN
FT                   AAIAPPSPEA"
     atgaaatcgc ttcttgatcg gctgacacgg atcggccacg gaaccaaccg ggccgccgtt        60
     ttcatcgcgc aggcagcctt gctgctgatg atgctgctga ccgtttactc ggtcatcgcg       120
     cggtacgtgc tccagcagcc cagcgtccac gccgtggaga tcagcattta cctgttgctg       180
     ctggtgacct ggctttcggt gggctggacc catctgctcg agcgccacgt cagcatggaa       240
     atgctcagca tccgcgtgcg cggacgcggc aagcggctgc tgaacgtgtt tcgcgagctg       300
     gtggtgctgg tgttctgcgg cttcctgctg catgccggcg tccagatcgc cgccacggca       360
     ctggcgcgca attaccgctc gacgtccctg ctggcctttc ccatgtggat cgcctacgga       420
     ctgatcgcgg tcggcgcgct gctcttggcg atcgccgccg cgtgcaagct gaaccatccc       480
     gacggcaacg ccgccattgc gccacccagc ccggaggcat ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page