(data stored in ACNUC1104 zone)

EMBL: BX640427.PE123

BX640427.PE123       Location/Qualifiers
FT   CDS_pept        complement(118815..119441)
FT                   /transl_table=11
FT                   /locus_tag="BPP1414"
FT                   /product="putative isochorismatase"
FT                   /note="Similar to Escherichia coli isochorismatase EntB or
FT                   EntG or B0595 or Z0737 or Ecs0634 SWALL:ENTB_ECOLI
FT                   (SWALL:P15048) (285 aa) fasta scores: E(): 2.2e-06, 30.15%
FT                   id in 189 aa, and to Arthrobacter sp N-carbamoylsarcosine
FT                   amidase SWALL:CSH_ARTSP (SWALL:P32400) (264 aa) fasta
FT                   scores: E(): 1.8e-12, 31.86% id in 204 aa"
FT                   /db_xref="GOA:Q7WAG3"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAG3"
FT                   /protein_id="CAE36716.1"
FT                   /translation="MLDLDNARGGFIGSHPFGRRPALVVIDFQRAFTDPDVSPLASDCA
FT                   PAIAQANRLIQAMRGRGPVVFTVVGYDGNHGDGGCFHRKCPPLKDLVRGSAGCALDERL
FT                   DYDAATDVLLHKTQASAFFGTPLAAMLAHAGCDAVLIAGCTTSGCVRASAVDAMQHGFP
FT                   PFVAQDAVTDRSAAQHLSNLIDLKSKYAEVLPTDALLPLLLNPTA"
     atgctagacc tcgacaatgc ccgaggcggt ttcatcggtt cacacccgtt cgggcgacgc        60
     ccggccctgg tggtgatcga tttccagcgg gctttcaccg acccggacgt cagtccgctg       120
     gccagcgatt gcgcgcccgc catcgcgcag gccaatcgcc tgatccaggc gatgcgcgga       180
     cgcggtccgg tggtgttcac ggtggtgggc tacgacggca accatggcga cggcggctgt       240
     tttcatcgca agtgcccgcc gctgaaggac ctggtacgcg gctcggcggg ctgcgcactc       300
     gacgagcgac tggattacga cgcggcgacc gacgtgctgc tgcacaagac gcaggcctcg       360
     gcgtttttcg gtacgccgct ggccgccatg ctcgcgcacg cgggctgcga cgccgtgctg       420
     atcgccggct gcaccaccag cggctgcgtg cgcgccagcg cggtcgacgc catgcagcac       480
     ggctttccgc ctttcgtggc gcaggacgcc gtcacggacc gttccgcggc ccagcacctc       540
     agcaacctga tcgacctcaa gagcaagtac gcggaagtcc tgccgaccga cgcgctcctg       600
     cccctgcttc tcaacccgac ggcctga                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page