(data stored in ACNUC1104 zone)

EMBL: BX640427.PE125

BX640427.PE125       Location/Qualifiers
FT   CDS_pept        120876..121847
FT                   /transl_table=11
FT                   /locus_tag="BPP1416"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2116"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAG1"
FT                   /protein_id="CAE36718.1"
FT                   /translation="MKIKSMLLAVLAVSMAGVSAAALSQGFPERALRVVVPYPPGGTTD
FT                   VLVRLLQKPVADAAGQSVVVDNRPGGASVIGTSHVAQAAPDGYTVLGGDLSMLVNPSLM
FT                   KDLPYDTLRDFRGVTMLARAPLVLLVHPSVPANTLDELIALAKARPGTLNFASGGYGTS
FT                   THMAGEMFRRAAGIDVVHVPYQGVAPAMSALLGGQVQMYFGGTTTGLPHIQSGKLRALA
FT                   VTGEAPSPLLPEVPTFVSRGIQGVNADTYWGVYAPARTPDAVIEKLNAYYTGALRDPAV
FT                   QQRTRDLGLTLIGNSAAEHTAQMKTMIGDWGAFVKEADIRLE"
     atgaagatca agagcatgct gcttgccgtg ctggcggtat cgatggccgg ggtatcggcc        60
     gccgcgctgt cccagggctt tcccgaacgg gcgctgcgcg tcgtggtgcc ctatccgccg       120
     ggcggcacca ccgatgtgct ggtgcgcctg ctgcaaaagc cggtggccga cgccgcgggg       180
     caatcggtgg tggtcgacaa ccggccgggc ggcgcgtcgg tcatcggcac ctcgcacgtg       240
     gcgcaagcgg ccccggatgg ctacaccgtg ctgggcggcg acctgtcgat gctggtcaac       300
     ccttcgctga tgaaagacct gccgtatgac accttgcggg atttccgcgg cgtcacgatg       360
     ctggcgcgcg cgccgctggt gctgctggtg catccgtcgg tgccggccaa caccctcgac       420
     gagctgatcg cgctggccaa ggccaggccg ggtacgctga acttcgcctc gggcggctac       480
     ggcacctcga cccacatggc gggcgagatg ttccgccgcg ccgcgggcat cgatgtcgtg       540
     catgtgccgt accagggcgt ggcgccggcc atgtcggcgc tgctgggcgg gcaggtgcag       600
     atgtatttcg gcggcaccac gacgggcctg ccgcatatcc agtcgggcaa gctgcgcgcg       660
     ctggcggtga cgggcgaggc gcccagtccg ctgctgcccg aggtgccgac cttcgtgtcg       720
     cgcggcatcc agggcgtgaa cgccgatacg tactggggcg tctacgcccc ggccaggacg       780
     cccgacgcgg tcatcgagaa gctgaatgcc tattacaccg gcgccttgcg cgaccccgcc       840
     gtgcaacagc gcacccgcga cctgggcctg accctgatcg gcaacagcgc cgccgagcat       900
     acggcccaga tgaagacgat gattggcgat tggggcgcct tcgtcaagga agcggacatc       960
     cgactggagt aa                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page