(data stored in ACNUC1104 zone)

EMBL: BX640427.PE126

BX640427.PE126       Location/Qualifiers
FT   CDS_pept        121851..122705
FT                   /transl_table=11
FT                   /locus_tag="BPP1417"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2115"
FT                   /db_xref="GOA:Q7WAG0"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR037950"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAG0"
FT                   /protein_id="CAE36719.1"
FT                   /translation="MAAKQSLVCLTFDFDAISVWLARGMDSPTPVSRGEFCAVAADRVL
FT                   DLLERLGLPSTWFIPGHTLASYPEHCRRVHEAGHEIGHHGWTHVAPNLMTREEELDGLV
FT                   RANEAIRALTGRAARGYRSPSWDLSPHTLALLLEHGFDYDSSMMGHDYLPYPVRQGDSF
FT                   PLDEPAVFGAPTRLIEVPVSWSLDDYPHFEFVRAGQSVIPGLMNANSVMDNWIEDFLYL
FT                   KENFDWGVITYTFHPFVIGRGHRMRMLERLLRRLIDEGATFVRMEEAVDAYRQRQALAA
FT                   GAA"
     atggccgcca aacaatccct ggtttgcctg accttcgatt tcgacgcgat ctcggtgtgg        60
     ctggcgcgcg gcatggacag tccgacgccg gtgtcgcgcg gcgagttctg cgccgtggcg       120
     gccgaccgcg tgctggactt gctcgaacgg ctgggcctgc cgtcgacctg gttcatcccc       180
     ggccatacct tggccagcta tccggagcat tgccggcgcg tgcacgaggc cggccatgaa       240
     atcggccacc acggctggac gcacgtcgcg cccaacctga tgacgcgcga ggaagagctc       300
     gacggcctgg tgcgcgcgaa cgaggcgatc cgcgcgctga cggggcgggc cgcgcgcggc       360
     taccgctcgc catcgtggga cctcagtccg cacaccctgg cgctgctgct cgagcacggc       420
     ttcgactacg acagcagcat gatggggcac gactatctgc cgtatccggt gcgccaggga       480
     gacagttttc ccctggacga acccgcggtg ttcggcgcgc ccacccgcct catcgaggtg       540
     cctgtcagct ggtcgctgga cgactatccg cacttcgagt tcgtgcgcgc cgggcagagc       600
     gtcatccccg gcctgatgaa tgccaacagc gtgatggaca actggatcga ggacttcctg       660
     tacctgaagg agaacttcga ctggggcgtc atcacctaca ccttccatcc tttcgtgatc       720
     ggccgcggcc accgcatgcg catgctcgag cgcctgctgc ggcgcctgat cgacgagggc       780
     gcgacgttcg tgcgcatgga ggaagcggtg gacgcgtacc ggcaacggca ggcgctggcc       840
     gccggcgccg catga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page