(data stored in ACNUC1104 zone)

EMBL: BX640427.PE13

BX640427.PE13        Location/Qualifiers
FT   CDS_pept        complement(11537..12691)
FT                   /transl_table=11
FT                   /locus_tag="BPP1304"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Thermoplasma volcanium L-carnitine
FT                   dehydratase Tv1186 or Tvg1215416 SWALL:Q979H5
FT                   (EMBL:AP000995) (399 aa) fasta scores: E(): 1.6e-53, 39.08%
FT                   id in 371 aa, and to Rhizobium meliloti putative conserved
FT                   membrane-anchored protein Rb0848 or Smb21182 SWALL:Q92V66
FT                   (EMBL:AL603645) (394 aa) fasta scores: E(): 3.5e-50, 37.83%
FT                   id in 378 aa"
FT                   /db_xref="GOA:Q7WAR5"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAR5"
FT                   /protein_id="CAE36606.1"
FT                   /translation="MTGALQGLRVLDMGQWIAAPYCTAMLADFGAEVIKIEKPGGGDDQ
FT                   RHSSPFVDGQSAFFNLFNRNKHSVTIDLSTPAGRAQCRDLIGSADVLVENYRPGVMARL
FT                   GLDYATLHAEFPRLVYCSISGFGQSGPMRGEGGFDLVIQAMSGLAAQCGPTDGPAHRLP
FT                   IPIVDVSTALFATIGVLTALAARQQTGTGQLVDVALLDSALAMAPLEVADYLATGHNPE
FT                   RMGQASRNAAPYQIFRTQDGAIALGAASQGLWEKTCDLLDRPALKNDPRFADNTARLAH
FT                   RAVLAELVEQALATQPSEHWLARLREAGIPAGPVLSYADILRHPQVAAREMVRRPETAG
FT                   AATAATLASPIRLSDTPARFVSGAPALGAHNGLLASGTRTGPPA"
     atgacgggag cactgcaagg cttgcgcgtc ctggacatgg gccaatggat cgcggcgccc        60
     tattgcaccg cgatgctggc ggacttcggc gccgaagtca tcaagatcga aaagcccggc       120
     ggcggcgacg accagcggca ctcttcccct ttcgtcgatg gacagagcgc tttcttcaac       180
     cttttcaatc gcaacaagca cagcgtcacg atcgacctct ccacgccggc cggccgcgcg       240
     caatgccgcg acctcatcgg cagcgccgat gtgctggtcg aaaactaccg gccaggcgtc       300
     atggcgcgcc tgggcctgga ctacgcgacc ctgcatgcgg agttcccgcg cctggtctat       360
     tgctcgatct cgggcttcgg ccaatccggc cccatgcgag gcgaaggcgg cttcgacctg       420
     gtcatccagg ccatgtccgg cctggccgcg cagtgcggcc cgaccgacgg ccccgcgcac       480
     cggctgccga ttcccatcgt cgacgtttcc acggccctgt tcgccaccat cggcgtgctt       540
     accgcgcttg ccgcgcgcca gcaaaccggc acggggcaat tggtcgacgt cgccttgctg       600
     gactcggcgc tggccatggc gccgctggag gtcgccgatt acctggccac gggccacaat       660
     cccgaacgca tgggacaggc ctcgcgcaac gccgcgccct accagatatt ccggacccag       720
     gacggcgcca ttgcgctggg cgcggcctcg cagggccttt gggagaaaac ctgcgacctg       780
     ctcgaccgtc ccgcgctgaa gaacgatcca cgcttcgccg acaacacggc ccggctggcc       840
     catcgcgcgg tcctggccga actggtcgaa caggccctgg ccacgcagcc gtccgaacac       900
     tggctggcgc gcctgcgcga ggcgggcatc cccgccggcc ccgtgctgag ctacgccgac       960
     attctccgcc atccgcaggt ggcggcgcgc gaaatggtgc gccggcccga aaccgccggc      1020
     gccgccacgg ccgcgacgct ggccagtccg atacgcctgt ccgatacccc ggcccgcttc      1080
     gtcagcggcg cgcccgccct gggcgcgcac aacgggctgc tggcgagcgg aacccggacc      1140
     ggcccgccgg catga                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page