(data stored in ACNUC1104 zone)

EMBL: BX640427.PE130

BX640427.PE130       Location/Qualifiers
FT   CDS_pept        complement(126099..127604)
FT                   /transl_table=11
FT                   /locus_tag="BPP1421"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2111"
FT                   /db_xref="GOA:Q7WAF6"
FT                   /db_xref="InterPro:IPR009197"
FT                   /db_xref="InterPro:IPR010799"
FT                   /db_xref="InterPro:IPR015995"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAF6"
FT                   /protein_id="CAE36723.1"
FT                   /translation="MHILVAGFQHETNTFAPSKAGYDNFLRGEGFPALVRGDDLLALRA
FT                   VNIPAGGFLNAALADGHSVHPVLWAGASPSAHVTRDAFERIAGEIEAAARAGRYDAVYL
FT                   DLHGAMVTEHHDDGEGELLRRLRDAVGPATPIVASLDLHANVTRAMLAHASALVAYHTY
FT                   PHVDMADTGARAAALLQARAQAGKHWHGAARRLPFLIPINGMCTQLEPARGVYALLAEL
FT                   ERSEPGIASLSCALGFPAADFPECGPVVWAHGPDRDAVERAVQTLADRIAGLEAQWAPD
FT                   FLAPDEAIRQARQLAQGARRPVVIADTQDNPGAGGDANTTGMLRALIDADADNAAIGLM
FT                   CDPQAVAQALAAGVGKCVRLRLGGQSGVAGDAPCEAEFIVEHQSDGKTRYDGPMMHGMA
FT                   ADLGPTVCLRHRGVRVIVSSNKSQTLDRNLIRLGGIDPEDLAILVVKSSVHFRADFEPI
FT                   AHAVLIAKAPGPMQADPADLPWTRLAPGMRTRPRGRPFVPARP"
     atgcatatcc tggttgccgg tttccaacac gaaaccaaca ccttcgcgcc ttccaaggcc        60
     ggctatgaca acttcctgcg cggcgaaggc tttcccgccc tggtgcgcgg cgacgacctg       120
     ctggcgctgc gcgccgtcaa catccccgcc ggcggcttcc tgaacgcggc cctggcggac       180
     ggccacagcg tgcaccccgt cctctgggcc ggcgccagcc cctcggcgca cgtcacgcgc       240
     gacgccttcg agcgtatcgc cggcgagatc gaggcggccg cccgcgccgg ccgctacgac       300
     gccgtctacc tggacctgca cggcgccatg gtcaccgaac accacgacga cggcgaaggc       360
     gaactcctgc gccgcctgcg cgacgccgtc ggccccgcca cgcccatcgt cgccagcctg       420
     gacctgcacg ccaacgtgac tcgcgccatg ctggcgcatg ccagcgcgct ggtggcctat       480
     cacacctatc cgcacgtcga catggccgac accggcgcgc gcgccgccgc cctgctgcaa       540
     gcgcgcgcgc aggccggcaa gcactggcat ggcgccgcgc ggcgcctgcc gttcctcatt       600
     cccatcaacg gcatgtgcac ccagctcgaa cccgcccggg gcgtgtatgc cctgctggcc       660
     gagctcgagc gcagcgaacc gggcatcgcc agcctgtcct gcgccctggg ctttccggcc       720
     gccgatttcc ccgagtgcgg cccagtcgtc tgggcccacg gccccgaccg cgacgccgtc       780
     gagcgcgccg tgcagaccct ggccgaccgc atcgccgggc tcgaagccca gtgggcgccc       840
     gacttcctcg ccccggacga agccatccgc caggcccggc agctggcgca aggcgcccgc       900
     cgccccgtgg tcatcgccga cacgcaggac aaccccggcg ccggcggcga cgccaacacc       960
     accggcatgc tgcgcgccct catcgacgcg gacgccgaca acgccgccat cggcctcatg      1020
     tgcgaccccc aggccgtcgc ccaggccctg gccgccggcg tgggcaagtg cgtacggctg      1080
     cgcctgggcg gccagtccgg cgtcgccggc gacgccccct gcgaagccga attcatcgtc      1140
     gaacaccagt ccgacggcaa gacccgctac gacggcccca tgatgcacgg catggcggcc      1200
     gacctcggcc ccaccgtctg cctgcgccac cgcggcgtgc gcgtcatcgt cagcagcaac      1260
     aaatcccaga ccctggaccg caacctcatc cgcctgggcg gcatcgaccc cgaagacctc      1320
     gccatcctgg tcgtcaagag ctcggtgcac tttcgcgccg acttcgaacc catcgcccac      1380
     gccgtgctga tcgccaaggc gcccggcccc atgcaggccg accccgccga cctgccctgg      1440
     acgcgcctgg cgcccggcat gcgcacccgc ccgcgcggcc ggcccttcgt ccctgcccgg      1500
     ccctga                                                                 1506
//

If you have problems or comments...

PBIL Back to PBIL home page