(data stored in ACNUC1104 zone)

EMBL: BX640427.PE132

BX640427.PE132       Location/Qualifiers
FT   CDS_pept        complement(128498..128944)
FT                   /transl_table=11
FT                   /locus_tag="BPP1423"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2109"
FT                   /db_xref="GOA:Q7WAF4"
FT                   /db_xref="InterPro:IPR007418"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAF4"
FT                   /protein_id="CAE36725.1"
FT                   /translation="MTYPILLALHLLAAFVFIGTVFFEVLILESVRRQVPREAMNAVER
FT                   GIGNRARAIMPWVLLALFGAGIGMAWQHRGALEQPLASSFGLLLSLKIVLALSVLGHFA
FT                   AAMRWRRRGQLRGRRSRRLHLSVFCHLVAIVLLAKGMYYIDALR"
     atgacctacc ccatcctgct ggccctgcac ctgctggccg ccttcgtctt catcggcacc        60
     gtcttcttcg aagtcctgat cctcgaaagc gtgcggcggc aagtgccgcg cgaagccatg       120
     aacgcggtcg agcgcggcat cggcaaccgc gcccgcgcca tcatgccgtg ggtgctgctg       180
     gcgctgttcg gcgccggcat cggcatggcc tggcagcacc gcggcgcgct cgagcagccg       240
     ctggccagca gcttcggcct gctgctcagc ctgaagatcg tgctggcgct cagcgtcctg       300
     ggccatttcg ccgccgccat gcgctggcgc cggcgcggcc aattgcgcgg ccggcgttcg       360
     cggcggctgc acctgagcgt gttctgccac ctcgtggcga tcgtgttgct ggccaagggg       420
     atgtactaca tcgacgcgtt gcgctga                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page