(data stored in ACNUC1104 zone)

EMBL: BX640427.PE133

BX640427.PE133       Location/Qualifiers
FT   CDS_pept        complement(128941..130167)
FT                   /transl_table=11
FT                   /locus_tag="BPP1424"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2108"
FT                   /db_xref="GOA:Q7WAF3"
FT                   /db_xref="InterPro:IPR010266"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAF3"
FT                   /protein_id="CAE36726.1"
FT                   /translation="MAELLQIDEPAAGRAAPQWRAFLELGFRPLYLVGAAWGALSVALW
FT                   IGAPQWLGGAMAGVIWHAHEMLWGFIGAIAVGFLLTAAATWTGVNPLRGAPLAALAALW
FT                   LAARAAFLLPGMAAFWTGVACELLFFAWAAAALGRAIYRRGASRRNDGVPLLVLGLGAA
FT                   DALYLLAARAGDYPLLLQRFNAGLLCMAVIALLIARRIIPFFAMRAIAGLQIPMHTRSG
FT                   QWQLAAGLVAVAATLAQAGALTAVALAAAGLIALAQWLSWRPWATRGVPLLWILYTGYL
FT                   GLAAGLLVAAASAAGGIARAAWPAHVIGMAGFGLLIIGMITRTALGHLGRPLRTDRLML
FT                   ACYLLVIGAAALRLAALWPGPHTLAALHGATAAWVLAFVLYLWRFAPLLVRPRLRAPTA
FT                   AAMPVRSRP"
     atggctgaac tgctgcaaat cgacgagccc gccgccggac gcgccgcgcc gcaatggcgc        60
     gccttcctgg aactgggctt tcgtccgctc tacctggtgg gcgcggcctg gggcgcgctg       120
     tcggtggcgc tgtggatcgg cgcgccgcag tggctgggcg gcgccatggc gggcgtcatc       180
     tggcatgcgc atgaaatgct gtggggcttc atcggcgcca tcgcggtggg cttcctgctg       240
     accgccgcgg ccacctggac cggcgtcaac ccgctgcgcg gcgcgccgct ggccgcgctg       300
     gccgcgctgt ggctggcggc ccgcgccgcc ttcctgctgc cgggcatggc cgccttctgg       360
     accggcgtgg cctgcgagct gctgttcttc gcctgggccg cggccgcgct gggccgggcc       420
     atctaccggc gcggcgccag ccggcgcaac gacggcgtgc ccttgctggt gctggggctg       480
     ggcgcggccg acgccctgta tctgctggcc gcccgcgccg gcgactaccc cttgctgctg       540
     cagcgcttca acgcgggcct gctgtgcatg gccgtgatcg ccctgctgat cgcgcgccgc       600
     atcattccct ttttcgccat gcgcgccatc gccggcctgc agatccccat gcatacgcgc       660
     agcggccaat ggcaactggc cgccggcctg gtcgccgtgg cggcgacgct ggcgcaggcc       720
     ggcgcgctga ccgccgtggc gctggccgcg gccggcctga tcgcgctggc gcaatggctg       780
     tcctggcgcc cctgggccac gcgcggcgtg cccctgctgt ggatcctgta caccggctac       840
     ctgggcctgg ccgccggcct gctggtggcg gcggcaagcg cggcgggcgg catcgcgcgc       900
     gccgcgtggc ctgcgcacgt catcggcatg gccggcttcg gcctgctcat catcggcatg       960
     atcacccgca ccgccctggg ccacctgggc cggccgctgc gcaccgaccg cctcatgctc      1020
     gcctgctacc tcctggtcat cggcgcggcc gcgctgcgcc tggccgccct ctggcccggc      1080
     ccgcacaccc tggccgcgct gcacggcgcc accgccgcct gggtgctggc gttcgtcctg      1140
     tacctgtggc gtttcgcgcc cctgctggtg cgcccgcgcc tgcgcgcacc aaccgccgcc      1200
     gccatgcccg tgcggtcccg cccatga                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page