(data stored in ACNUC1104 zone)

EMBL: BX640427.PE135

BX640427.PE135       Location/Qualifiers
FT   CDS_pept        130724..131026
FT                   /transl_table=11
FT                   /locus_tag="BPP1426"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2106"
FT                   /db_xref="InterPro:IPR011893"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="PDB:2OJL"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAF1"
FT                   /protein_id="CAE36728.1"
FT                   /translation="MITPPDHPPRIAIQYCTQCQWLLRAAWMAQELLSTFGADLGEVAL
FT                   VPGTGGVFRIHYNGAPLWDREVDGGFPEAKVLKQRVRDHLDPGRPLGHIDGRPKP"
     atgatcacgc cgccagacca tcccccccgc atcgccatcc agtattgcac gcagtgccag        60
     tggctgctgc gcgcggcctg gatggcgcag gagctgcttt cgaccttcgg cgccgacctg       120
     ggcgaggtgg ccctggtgcc cggcaccggc ggggtgttcc gcatccacta caacggcgcg       180
     ccgctgtggg accgcgaggt cgacggcggc tttcccgagg ccaaggtgct caagcagcgg       240
     gtgcgcgacc atctcgatcc gggccgtccg ctcggccata tcgacggccg tcccaagccc       300
     tag                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page