(data stored in ACNUC1104 zone)

EMBL: BX640427.PE138

BX640427.PE138       Location/Qualifiers
FT   CDS_pept        complement(132537..133325)
FT                   /transl_table=11
FT                   /locus_tag="BPP1429"
FT                   /product="putative amino-acid ABC transporter, periplasmic
FT                   amino acid-binding protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1364"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAE8"
FT                   /protein_id="CAE36731.1"
FT                   /translation="MNFSLRKLLLAGLVPLAMVGTAAQADDLAAIKAAGVIKIGTEGTY
FT                   APFSYHDASNKLTGFDVEIGRAIAQKLGVKAEFVEGKWDGLIAGLDVKRYDAVINQVGI
FT                   TDARKAKYDFSDPYISSQAALIVREDNQAIKSFADLKGRKSANTLTSNFGKLAQSYGAE
FT                   VVPVQGFNEAIDLLMSGRVEATVNDNLSFLDFKKQKPNAKVKVAAYDKSKEFSESGVLI
FT                   RKNNPELQAAINKALAELKADGTYRKISEQYFGADLSAAQ"
     atgaacttct ccttgcgcaa actgctgctt gccggcctgg tgccgctggc catggtcggc        60
     acggccgccc aggccgacga cctggccgcc atcaaggcgg ccggcgtcat caagatcggc       120
     accgagggga cctacgcccc gttcagctat cacgacgcca gcaacaagct gaccggcttc       180
     gacgtggaga tcggccgcgc catcgcccag aagctgggcg tgaaagccga gttcgtcgaa       240
     ggcaagtggg acgggctgat cgccggcctg gacgtcaagc gctacgacgc cgtcatcaac       300
     caggtcggca tcaccgatgc gcgcaaggcc aagtacgatt tctcggaccc ctacatctcg       360
     tcgcaggccg cgctgatcgt gcgcgaggac aaccaggcca tcaagtcgtt cgccgacctg       420
     aagggccgca agtcggccaa taccctgacc agcaacttcg gcaagctggc gcagagctat       480
     ggcgccgaag tggtgccggt gcaggggttc aacgaagcca tcgacctgct catgtcgggc       540
     cgcgtcgagg ccacggtcaa cgacaacctg tcgtttctcg acttcaagaa gcaaaagccc       600
     aacgccaagg tcaaggtggc agcctacgac aagagcaagg agttcagcga atcgggcgtg       660
     ctgatccgca agaacaaccc cgagctgcag gccgccatca acaaggcgct ggccgagctg       720
     aaggccgacg gcacctaccg gaagatctcc gagcagtact tcggcgccga cctgtcggcc       780
     gcccagtaa                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page