(data stored in ACNUC1104 zone)

EMBL: BX640427.PE141

BX640427.PE141       Location/Qualifiers
FT   CDS_pept        136512..137096
FT                   /transl_table=11
FT                   /locus_tag="BPP1432"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2703"
FT                   /db_xref="GOA:Q7WAE5"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR026021"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAE5"
FT                   /protein_id="CAE36734.1"
FT                   /translation="MTVSPLHALTSRRSMKFLRAPAPKQDELEQILQAAMSAPDHGALR
FT                   PWRFVLIRGEAIGRLADLAIEAVKRSGDKRMTPEKEKSVREWAAGVPLFIAVAQKISHD
FT                   NTRIPEQEQLLATGAAVMNILNAAHMLGYGAFWSTGLGTYVEDVQDALGLDAMDYRFLG
FT                   FVALGTPGCAVPPAQRPDFREFVSEWQGVTV"
     atgaccgtat ctcccttgca cgcgctgacg tcgcgccgtt cgatgaagtt cctgcgcgcg        60
     cccgcgccca agcaggacga actggagcaa atcctgcagg ccgccatgag cgcgcccgac       120
     catggcgcgc tgcgcccgtg gcggttcgtg ctgatccggg gcgaggccat cggccggctg       180
     gccgacctgg cgatcgaggc ggtcaagcgc agcggcgaca agcgcatgac gcccgagaaa       240
     gagaagtcgg tgcgcgaatg ggccgccggc gtgccgctgt tcatcgccgt ggcgcagaag       300
     atttcgcatg acaacacccg cattcccgag caggaacagc tgctggccac cggcgcggcg       360
     gtcatgaaca tcctcaacgc cgcgcacatg ctggggtacg gcgcgttctg gagcacgggc       420
     ctgggcactt acgtcgagga cgtgcaggac gcgctgggcc tggacgcgat ggactaccgc       480
     ttcctgggct tcgtggccct gggcacgccg ggctgcgcgg tgccgccggc gcagcgcccg       540
     gatttccgcg agttcgtgtc cgaatggcag ggcgtcaccg tctga                       585
//

If you have problems or comments...

PBIL Back to PBIL home page