(data stored in ACNUC1104 zone)

EMBL: BX640427.PE143

BX640427.PE143       Location/Qualifiers
FT   CDS_pept        138695..140041
FT                   /transl_table=11
FT                   /locus_tag="BPP1434"
FT                   /product="putative membrane transport protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2701"
FT                   /db_xref="GOA:Q7WAE3"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR030192"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAE3"
FT                   /protein_id="CAE36736.1"
FT                   /translation="MLPKELENVVATLDNYVPDTAWGQTLVGIGVLVLTALFVQWVVAR
FT                   VVLYFAHRLLVLSGREDWDRALSRRRAYQNFWYAVPFAVVSMGIELVPHAERAVTVVGR
FT                   LSHAGAWICVFVAFSGVLSAWQDTYSATTRAQTRSIKGYIQIGKLILCAVGAVLVLSIL
FT                   LDRSPLWMISGLGALSAVLLLVFKDTLLSLVASTQLTSNDMLRIGDWIEMPQANADGFV
FT                   KDIALHTVKVQNWDNTVTTVPTYKLFSESYRNYRHMFESGGRRIKRTLRLDAASVRFMN
FT                   EEEGGRLKRFVLLRDYLQAKEDALLEANRQLGELAEVPANRRRLTNIGTFRGYALAYLR
FT                   QHPEVRQDMAMMVRMMEPQPNGIPIEIYCFTAITAWVEYERIQGDIFDHLLAILPELGL
FT                   RLFQEPSGSDLGNLAGGMREAALHEFRREQVAAGEAPLALRGDGAAPVR"
     gtgctgccga aggaattgga gaacgtggtc gccacgctgg acaactatgt gccggacacg        60
     gcatggggcc agacgctggt cggcatcggc gtgctggtgc tgacggcgct gttcgtccaa       120
     tgggtggtgg cgcgcgtcgt gctgtatttc gcccaccggc tgctggtgct gagcggccgc       180
     gaggactggg accgcgccct gagccgccgc cgcgcctacc agaacttctg gtacgcggtg       240
     ccgttcgcgg tggtctccat gggcatagaa ctggtgccgc atgccgagcg cgcggtcacc       300
     gtcgtgggcc ggctgtcgca cgccggggcc tggatctgcg tgttcgtggc cttcagcggc       360
     gtgctcagcg cctggcagga tacctattcg gccaccacgc gggcgcagac gcgctcgatc       420
     aagggctata tccagatcgg taagctgatc ctgtgcgcgg tgggggcggt gctggtgctc       480
     tccatcctgc tggaccgctc gccgctgtgg atgatctccg gcctgggcgc gctgtcggcg       540
     gtgctgctgc tggtgttcaa ggacacgctg ctgtcgctgg tggccagcac ccagctcacg       600
     tccaacgaca tgctgcgcat cggcgactgg atcgagatgc cgcaggccaa cgccgacggc       660
     ttcgtcaagg acatcgcgct gcataccgtc aaggtgcaga actgggacaa cacggtgacc       720
     accgtgccca cctacaagct gttttccgaa agctaccgca actaccgcca catgttcgag       780
     tcgggcgggc ggcgcatcaa gcgcaccctg cggctggacg cggccagcgt gcgcttcatg       840
     aacgaggaag agggcggacg gctcaagcgc ttcgtgctgc tgcgcgacta cctgcaggcc       900
     aaggaggacg cgctgctgga ggccaaccgc cagctgggcg aactggccga ggtgccggcc       960
     aaccgccgcc gcctgaccaa catcggcacc ttccgcggct atgcgctggc ctacctgcgc      1020
     cagcaccccg aggtgcgcca ggacatggcc atgatggtgc gcatgatgga gccgcagccc      1080
     aacggcatcc cgatcgagat ctattgcttc acggccatca ccgcctgggt cgagtacgag      1140
     cgcatccagg gcgacatctt cgaccatctg ctggccatcc tgcccgagct ggggctgcgg      1200
     ctgttccagg agccctccgg ctcggacctg ggcaacctgg ccggcggcat gcgcgaggcg      1260
     gccctgcacg agttccggcg cgagcaggtg gccgcgggcg aggcgccgct ggcgctgcgc      1320
     ggcgacggcg ccgcgcccgt gcgataa                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page