(data stored in ACNUC1104 zone)

EMBL: BX640427.PE153

BX640427.PE153       Location/Qualifiers
FT   CDS_pept        149982..150926
FT                   /transl_table=11
FT                   /locus_tag="BPP1444"
FT                   /product="ABC-transport protein, inner membrane component"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2691"
FT                   /db_xref="GOA:Q7WAD3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAD3"
FT                   /protein_id="CAE36746.1"
FT                   /translation="MFKLILRRVVVAIPTLILVSMIVFMLQKILPGDPVLTLAGEERDP
FT                   AVLDYLREKYRLNDPLPVQYGAWVAQVLQGDLGKSMRTDVPVLTLIAQKLPVTLQLAVM
FT                   AMAFALLVGIPLGIVAAVRKGTAVEMGANMAALSGMSIPNFWLGIILIMVVSVQWKLLP
FT                   ASGYVSPAEDFWLSIKTMLMPALALSTAIAAYLMRHTRSAMLEALSADYVRTARAKGVA
FT                   PRKVVLRHALRNALMPIVTLVTLLFGELLAGAVLTEQVFTIPGFGKLIVDAVFNRDYAV
FT                   VQGVVLCVAVGFIVMNLLADILYILVNPRLRHA"
     atgttcaaac tgatcctgcg acgcgtcgtc gtggcgatcc cgacgctgat cctggtgtcg        60
     atgatcgtct tcatgctgca gaaaatcctg cccggcgatc cggtgctcac gctggccggc       120
     gaggagcgcg atcccgcggt gctggactac ctgcgcgaga aataccgcct caacgacccg       180
     ctgccggtgc agtacggcgc ctgggtggcc caggtgctgc agggcgacct gggcaagtcc       240
     atgcgcaccg acgtgccggt gctgaccctg atcgcgcaaa agctgccggt gaccctgcag       300
     ctggccgtga tggcgatggc gttcgcgctg ctggtgggca ttcccctggg catcgtcgcc       360
     gccgtgcgca agggcacggc ggtcgagatg ggcgccaaca tggccgcgct ctcgggcatg       420
     tccattccca atttctggct gggcatcatc ctcatcatgg tggtctcggt gcagtggaag       480
     ctgctgccgg cctccggcta tgtctcgccg gccgaggact tctggctttc catcaagacc       540
     atgctgatgc cggccctggc gctgtccacg gcgatcgccg cctacctgat gcggcacacg       600
     cgttcggcca tgctggaggc gctgtcggcc gattacgtgc gcaccgcgcg cgccaagggc       660
     gttgcgccgc gcaaggtggt gctgcgccac gcgctgcgca acgcgctgat gcccatcgtg       720
     acgctggtga cgctgctgtt cggcgaactg ctggccgggg cggtgctgac cgagcaggtg       780
     ttcaccattc cgggtttcgg caagctgatc gtcgacgcgg tcttcaaccg cgactacgcc       840
     gtggtccagg gcgtggtgct gtgcgtggcg gtcggcttca tcgtcatgaa cctgctggcc       900
     gacatcctgt acatcctcgt caacccccgc ctgaggcacg catga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page