(data stored in ACNUC1104 zone)

EMBL: BX640427.PE154

BX640427.PE154       Location/Qualifiers
FT   CDS_pept        150923..151798
FT                   /transl_table=11
FT                   /locus_tag="BPP1445"
FT                   /product="probable ABC-transport protein, inner membrane
FT                   component"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2690"
FT                   /db_xref="GOA:Q7WAD2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAD2"
FT                   /protein_id="CAE36747.1"
FT                   /translation="MSAPIASAGMAAPRRANRSWGKFRRNRIAMLGALIVLAFVVLALL
FT                   APWVASHDPFQTSFMTIRKAPSAAFWMGTDELGRDIFSRMVYGARASLMAGMVSVLIAL
FT                   AVGVPFGLAAGYFGGWTDSVISRATEALLAIPFLILAIALAAFLGPSLTNAMIAIGVSA
FT                   APKFIRLTRGQVLAVKNEDYVQSARALGASDLRIIGRHVFPNVMPPLIVQATITIATAI
FT                   IAEASLSFLGLGLQPPNPSWGSMLNTAKNFMTQAPWMSIFPGSAIFLVVLGFNLLGDGL
FT                   RDALDPRQEK"
     atgagcgcac ccatcgcaag cgcgggcatg gccgcgccgc gccgcgccaa ccgctcctgg        60
     ggcaagttcc gccgcaaccg gattgcgatg ctgggcgcgc tcatcgtgct ggcgttcgtc       120
     gtgctggcgc tgctggcgcc ctgggtggcc agccacgacc cgttccagac cagcttcatg       180
     accatccgca aggcgccctc ggcggcgttc tggatgggca ccgatgaact gggccgggac       240
     attttcagcc gcatggtgta cggcgcgcgc gcctcgctga tggcgggcat ggtgtcggtg       300
     ctgatcgccc tggcggtggg ggtgccgttc ggactggccg ccggctattt cggcggctgg       360
     accgacagcg tcatctcgcg cgccaccgag gcgctgctgg ccattccgtt cctgatcctg       420
     gcgatcgcgc tggccgcctt cctggggccc agcctgacca acgccatgat cgccatcggc       480
     gtgtcggccg cgcccaagtt catccggctc acgcgcggcc aggtgctggc cgtcaagaac       540
     gaggactacg tgcagagcgc gcgcgccctg ggcgcctcgg acctgcgcat catcggccgc       600
     cacgtctttc ccaatgtcat gccgccgctg atcgtgcagg ccaccatcac catcgccacc       660
     gccatcatcg ccgaggccag cctgtcgttc ctggggctgg gcctgcagcc gcccaatcca       720
     tcctgggggt cgatgctcaa cacggccaag aacttcatga cccaggcgcc ctggatgtcc       780
     atcttccccg gctcggcgat cttcctggtg gtgctgggct tcaacctgtt gggcgacggc       840
     ctgcgcgacg cgctggatcc gcgccaggag aagtag                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page