(data stored in ACNUC1104 zone)

EMBL: BX640427.PE156

BX640427.PE156       Location/Qualifiers
FT   CDS_pept        complement(153661..154305)
FT                   /transl_table=11
FT                   /locus_tag="BPP1447"
FT                   /product="LysE-family efflux protein"
FT                   /note="Similar to Caulobacter crescentus efflux protein,
FT                   LysE family Cc0456 SWALL:Q9AAY6 (EMBL:AE005719) (208 aa)
FT                   fasta scores: E(): 6.7e-38, 56.54% id in 214 aa, and to
FT                   Zymomonas mobilis hypothetical 17.5 kDa protein Zm10orf7
FT                   SWALL:Q9XBR8 (EMBL:AF157493) (158 aa) fasta scores: E():
FT                   1.1e-22, 49.06% id in 161 aa"
FT                   /db_xref="GOA:Q7WAD1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAD1"
FT                   /protein_id="CAE36749.1"
FT                   /translation="MTPLAALLAFTVAATLLTITPGLDTALVLRTAAIDGPRRALLAGL
FT                   GVCAGCLAWGVAAALGLGALLAASSLAYDALRIAGAIYLCWLGARLLARSLRRRAGDAA
FT                   PGMLPAAPAGGGALQWFWRGCLTNMLNPKVGVFYVTFLPQFIPAGVDVLAFSLLLAALH
FT                   AALGLLWFAALVAATRPLSRWLARPSVARGLDRLSAGVFIAFGLKLALERR"
     atgacgcctc ttgccgccct gctggccttc accgtggccg ccaccctgct caccatcacc        60
     cccggcctgg acaccgccct ggtgctgcgc accgcggcga tcgacgggcc gcgccgcgcg       120
     ctgctggccg gcctgggcgt atgcgccggc tgcctggcct ggggcgtggc cgccgcgctc       180
     ggcctgggcg cgctgctggc ggcgtcctcg ctggcctacg acgcgctgcg catcgccggg       240
     gcgatctacc tgtgctggct gggcgcgcgc ctgctggccc gcagcctgcg ccggcgcgcc       300
     ggcgacgcgg cccccggcat gctgccggcc gcgccggccg gcggcggcgc cttgcaatgg       360
     ttctggcgcg gctgcctgac caacatgctc aaccccaagg tcggcgtctt ctacgtcacg       420
     ttcctgccgc aattcatccc ggccggggtg gacgtgctgg cattcagcct gctgctggcc       480
     gcgctgcacg ccgcgctggg cctgctgtgg ttcgccgccc tggtggcggc cacccggccg       540
     ttgtcgcgct ggctggcgcg cccctcggtg gcgcgcgggc tcgaccgcct gagcgctggc       600
     gtcttcatcg ccttcggcct gaagctggcg ctggagcggc gctga                       645
//

If you have problems or comments...

PBIL Back to PBIL home page