(data stored in ACNUC1104 zone)

EMBL: BX640427.PE157

BX640427.PE157       Location/Qualifiers
FT   CDS_pept        154397..154933
FT                   /transl_table=11
FT                   /locus_tag="BPP1448"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Ralstonia solanacearum hypothetical
FT                   protein Rsc0785 or Rs05053 SWALL:Q8Y1A5 (EMBL:AL646061)
FT                   (182 aa) fasta scores: E(): 1.5e-37, 55.23% id in 172 aa,
FT                   and to Yersinia pestis hypothetical protein Ypo1065
FT                   SWALL:Q8ZH46 (EMBL:AJ414146) (182 aa) fasta scores: E():
FT                   1.1e-30, 46.06% id in 178 aa"
FT                   /db_xref="InterPro:IPR009822"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038590"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAD0"
FT                   /protein_id="CAE36750.1"
FT                   /translation="MALRATIYKADLHVADTDRHYYASHGLTIARHPSETDERMMVRVL
FT                   AYALHADEQLAFTKGLSDTDEPDLWRKDLTGDIELWVEVGQPDERRILKACGRAAEVVV
FT                   YCYGGHASQVWWDGVRGKLERARNLRVVCLPAAQTEALAQLARRTMQVHVNISDGAAFV
FT                   STDEGQVQVEPQSWR"
     atggccctgc gcgcaaccat ttacaaggcg gacctgcatg tcgccgatac cgaccgccac        60
     tattatgcta gccatggcct gaccatcgcg cgtcatccgt ccgagacgga cgagcgcatg       120
     atggtgcggg tgctggccta tgcgctgcac gccgacgaac agctcgcctt caccaagggg       180
     ttgagcgata ccgacgagcc ggacctctgg cgcaaggacc tgaccggcga tatcgaactg       240
     tgggtcgagg tcggccagcc cgacgagcgg cgcatcctca aggcctgcgg gcgcgccgcc       300
     gaggtcgtgg tgtattgcta cggcggccat gcctcgcagg tctggtggga cggcgtgcgc       360
     ggcaagctgg agcgcgcgcg caacctgcgc gtggtctgcc tgcccgcggc gcagaccgag       420
     gcgctggcgc agctggcgcg ccgcaccatg caggtgcatg tcaatatctc cgacggcgcg       480
     gccttcgtca gcaccgatga gggccaggtc caggtcgagc cgcaatcctg gcgctga          537
//

If you have problems or comments...

PBIL Back to PBIL home page