(data stored in ACNUC1104 zone)

EMBL: BX640427.PE159

BX640427.PE159       Location/Qualifiers
FT   CDS_pept        complement(156325..156897)
FT                   /transl_table=11
FT                   /locus_tag="BPP1450"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0981"
FT                   /db_xref="GOA:Q7WAC9"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WAC9"
FT                   /protein_id="CAE36752.1"
FT                   /translation="MTTPIPLARGWLPAAPSTLDPLRKYWLFRPGALTAGLRQLGHVRL
FT                   RVLAEYPTGAPRDEADGMRIAAQSPVWVREVLMSIDGVDSVVARSLTPLRASHGVWQGM
FT                   RRLLTRPLADMLYHDPGIHRSVFVCRRLAAGVPFHATAIARAPAGGPEPALWARRSAFW
FT                   RAGQPLLVAECFLPAFWSLARAPVAPR"
     atgaccaccc ccattcccct tgcgcgcggc tggctgcccg ccgcgccctc gacgctggat        60
     cccttgcgca agtattggct gttccgtccc ggcgcgctca ccgccggcct gcgccagctg       120
     ggccacgtac gcctgcgcgt gctggcagag tacccgaccg gcgcgccccg cgacgaggcc       180
     gacggcatgc gcatcgccgc gcaaagcccg gtctgggtgc gcgaagtgct gatgtcgatc       240
     gacggcgtgg acagcgtcgt ggcgcgcagc ctcacgccgc tgcgcgcctc gcatggcgtc       300
     tggcagggca tgcggcgcct gctgacgcgc ccgctggccg acatgctgta ccacgatccc       360
     ggcatccatc gttcggtctt cgtatgccgc cggctggccg ccggcgtgcc cttccatgcc       420
     accgccatcg cgcgcgcgcc ggccggcggc cccgagccgg cgctgtgggc gcgccgctcc       480
     gccttctggc gcgccggcca gccgctgctg gtggccgagt gcttcctgcc cgccttctgg       540
     tcgctggcgc gcgcgcctgt cgcgccgcgc tga                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page