(data stored in ACNUC1104 zone)

EMBL: BX640427.PE16

BX640427.PE16        Location/Qualifiers
FT   CDS_pept        complement(14562..15305)
FT                   /transl_table=11
FT                   /locus_tag="BPP1307"
FT                   /product="probable GntR-family transcriptional regulator"
FT                   /note="Similar to Deinococcus radiodurans transcriptional
FT                   regulator, GntR family Dra0211 SWALL:Q9RYU6 (EMBL:AE001863)
FT                   (279 aa) fasta scores: E(): 3e-12, 32.91% id in 237 aa, and
FT                   to Ralstonia solanacearum putative DNA-binding
FT                   transcriptional regulator Rsp0079 or Rs05542 SWALL:Q8XTM7
FT                   (EMBL:AL646076) (273 aa) fasta scores: E(): 5.5e-11, 30.9%
FT                   id in 220 aa"
FT                   /db_xref="GOA:Q7WAR2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAR2"
FT                   /protein_id="CAE36609.1"
FT                   /translation="MATVKDDLLASGSNKRYVNLAHLLRMRIRAGDYRPGDRLPAIDQL
FT                   ARQFNTAVVTARQALALLERNGLVQRRQGVGTFVLDDAVAPVGLELPLDQDWSGIRALW
FT                   GASQVRILAERDRVECPADYAQHGQPADAYFYMRRVHEAQGIPYTVADIYIDREVYRKA
FT                   PKRFRHEIALHVLPQLLPQRKLEAFEMIQVDAADVELAKWLDIAVGAPVVIMKRVVRDE
FT                   SGRIIYAGTPVYRGDIVRLDRTFKL"
     atggccaccg tgaaagacga cttgctggca agcggttcga acaaacgcta tgtcaatctg        60
     gcgcacctgc tgcgcatgcg tatccgcgcc ggcgactatc gcccgggcga ccggctgccc       120
     gccatcgatc aattggcccg gcagttcaac accgccgtcg tcaccgcgcg ccaggccctg       180
     gccttgctcg agcgcaacgg cctggtccag cgccgccagg gcgtcggcac cttcgtcctg       240
     gacgacgccg tggcgccggt aggcctggag cttccgctgg accaggactg gagcggtatt       300
     cgggccctgt ggggcgccag ccaggtgcgc atcctggccg aacgcgaccg ggtcgagtgc       360
     cccgccgact atgcccagca cggacagccc gcggacgcct atttctacat gcgccgcgtg       420
     cacgaggccc agggcattcc ctataccgtg gccgacatct acatcgaccg cgaggtgtac       480
     cgcaaggcgc ccaagcgctt tcgccatgag attgcgctgc acgtcctgcc gcagctcctg       540
     ccgcagcgca agctggaggc cttcgaaatg atccaggtcg atgccgccga cgtggagctg       600
     gccaagtggc tggatatcgc cgtgggcgcg cccgtcgtca tcatgaagcg cgtcgtgcgc       660
     gatgagtcgg gccgcatcat ctacgcagga acgcccgtct atcggggcga catcgtccgg       720
     ctggaccgga ccttcaaact ataa                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page