(data stored in ACNUC1104 zone)

EMBL: BX640427.PE165

BX640427.PE165       Location/Qualifiers
FT   CDS_pept        complement(164823..165074)
FT                   /transl_table=11
FT                   /locus_tag="BPP1456"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0987"
FT                   /db_xref="GOA:Q7WAC3"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAC3"
FT                   /protein_id="CAE36758.1"
FT                   /translation="MSIIIMIIVGFVVGLIARAIMPGDQNMGYIMTTILGIIGSVVAGF
FT                   LGQQLGWYAPGEPAGWIGSVVGAIIVLFVVGLVAKKRA"
     atgagcatca tcatcatgat catcgtcggg tttgtcgtcg gactgatcgc ccgggccatc        60
     atgccgggag accagaacat gggctacatc atgacgacga tcctgggcat catcggatcg       120
     gtggtcgccg gtttcctggg ccagcaactg ggctggtacg caccgggcga acccgcgggc       180
     tggatcggtt cggtcgtcgg cgcgatcatc gtgttgttcg tcgtgggcct ggtcgccaag       240
     aagcgcgcct ga                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page