(data stored in ACNUC1104 zone)

EMBL: BX640427.PE166

BX640427.PE166       Location/Qualifiers
FT   CDS_pept        complement(165220..165870)
FT                   /transl_table=11
FT                   /locus_tag="BPP1457"
FT                   /product="putative exported protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP0988"
FT                   /db_xref="GOA:Q7WAC2"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAC2"
FT                   /protein_id="CAE36759.1"
FT                   /translation="MRAPHRRLAVSTMYSPLSGRAWRGLLLAMLMLLAACSERSADWSL
FT                   YNVKGHLPDLKFSLPGAHGKTVSSDDLKGKTVLLFFGYASCPDVCPTTMAQLTAVLQQL
FT                   GEQARDVRILFVSVDPHRDTPDILQAYVNAFNNNAIGVTGNEKQIADLARRYRLAYQIE
FT                   KPKPGDDADIYDVTHSRGVYIFDNQGKARLLASDTDTIDTMVKDLRQLIAQTQ"
     atgcgcgcgc cgcatcggcg cctggctgta tctaccatgt actcacctct ttccggccgc        60
     gcgtggcgcg gcctgctcct ggcgatgttg atgctgctgg cggcgtgcag cgaacgttcg       120
     gcggattggt cgctgtacaa cgtcaagggc catctgcccg acctgaagtt cagcctgccg       180
     ggcgcgcacg gcaagaccgt cagcagcgac gacctcaagg gcaagacggt attgctgttc       240
     ttcggctacg ccagctgtcc cgacgtctgc cccaccacca tggcgcaact gacggcggtg       300
     ctgcagcaac tgggcgagca ggccagggac gtgcgcatcc tgttcgtcag cgtcgacccg       360
     catcgcgata ccccggacat cctgcaggcc tatgtcaatg cgttcaacaa caacgcgatc       420
     ggcgtgaccg gcaacgaaaa gcagatcgcc gacctggcgc ggcgctatcg gttggcctac       480
     cagatcgaga agcccaagcc gggcgacgac gccgatatct acgacgtcac ccacagccgc       540
     ggcgtctata tcttcgacaa ccagggcaag gcgcgcctgc tggcctccga cacggacacc       600
     atcgacacca tggtcaagga cctgcgccag ctcatcgcgc agacccaatg a                651
//

If you have problems or comments...

PBIL Back to PBIL home page