(data stored in ACNUC1104 zone)

EMBL: BX640427.PE17

BX640427.PE17        Location/Qualifiers
FT   CDS_pept        complement(15487..16476)
FT                   /transl_table=11
FT                   /locus_tag="BPP1308"
FT                   /product="putative exported protein"
FT                   /note="Similar to Rhizobium meliloti hypothetical protein
FT                   Ra1058 or Sma1927 SWALL:Q92Y30 (EMBL:AE007292) (330 aa)
FT                   fasta scores: E(): 1.5e-43, 42.03% id in 314 aa, and to
FT                   Comamonas testosteroni OrfJ protein SWALL:Q9RHM9
FT                   (EMBL:AB029044) (326 aa) fasta scores: E(): 9.3e-40, 39.51%
FT                   id in 329 aa"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAR1"
FT                   /protein_id="CAE36610.1"
FT                   /translation="MQPRLTALHSALAALALCLPAGQAHAQADAAYPARPITLIVPFSA
FT                   GGGSDVVARILATGLGSQLKQTVIVENRTGAAGNIGAEAVARARPDGYTLLFGSMGVMS
FT                   VNSHLYRNMPLQPERDLAPVGRIYDTPHVIVVGQQSTLKSLPQLIEQAKARPDALTYAS
FT                   AGNGTSTHLVGALFMHETGTRLMHVPYKGNAPALNDTMAGHVDMMFDQATNSTGQIQAA
FT                   RLRALAATSHARIPDLPDVPTVAELGYPELEVTSWTVLAAPKATPAAAMATLSTALKKT
FT                   LADPAIKEKIRQTGGVINYQDLPSTTEFVNRETARWGALIQSAGITAN"
     atgcaacccc gactcaccgc gctgcacagc gccctggcgg cgctggcgct atgcttgccg        60
     gccggccagg cgcacgcgca agccgacgcc gcgtatccgg cgcgccccat caccctcatc       120
     gtgccgttct cggccggcgg cggcagcgac gtcgtcgcgc gcatcctcgc caccggcctg       180
     ggcagccagc tcaagcagac cgtcatcgtc gagaaccgca ccggcgccgc cggcaatatc       240
     ggcgccgagg ccgtggcccg cgccaggccg gacggctaca ccctgctgtt cggcagtatg       300
     ggcgtgatga gcgtcaacag ccacctgtac cgcaacatgc cgttgcagcc cgaacgcgat       360
     ctcgcgccgg tgggacgcat ctacgacacg ccgcatgtca tcgtggtggg ccagcagtcc       420
     acgctcaaga gcctgccgca actgatagaa caggccaagg cccggcccga cgcgctgacg       480
     tacgcgtcgg cgggcaacgg cacctccacg cacctggtcg gcgccctgtt catgcacgag       540
     accggcaccc ggctgatgca cgtcccgtac aagggcaatg cgccggccct caacgacacc       600
     atggccggcc acgtggacat gatgttcgac caggccacca actccaccgg ccagatccag       660
     gccgcgcgcc tgcgcgcgct ggcggccacc tcccatgcgc ggattccgga cctgcccgat       720
     gtgcccacgg tggccgaact gggctatccc gagctggagg tcacttcgtg gacggtgctc       780
     gccgcgccca aggccacccc ggccgccgcc atggccacct tgagcacagc gctgaagaaa       840
     accctggccg accccgccat caaggaaaaa atccgccaga ccggcggggt gatcaattac       900
     caggaccttc cgtccaccac cgaattcgtc aaccgcgaga ccgcgcgctg gggcgccctg       960
     atccagtcgg ccggcatcac ggccaactga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page