(data stored in ACNUC1104 zone)

EMBL: BX640427.PE186

BX640427.PE186       Location/Qualifiers
FT   CDS_pept        190423..190812
FT                   /transl_table=11
FT                   /gene="cheY"
FT                   /locus_tag="BPP1477"
FT                   /product="chemotaxis protein CheY"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1033"
FT                   /db_xref="GOA:Q7WAA3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAA3"
FT                   /protein_id="CAE36779.1"
FT                   /translation="MVDKGMKILVVDDFPTMRRIIRNLLKELGFENVDEAEDGAIGLEK
FT                   LRNGAFQFVVSDWNMPNLDGLEMLKQIRADAALKSLPVLMVTAEAKKENIVAAAQAGAN
FT                   GYVVKAFTAATLEEKLNKIFEKLAG"
     atggtagata agggaatgaa gatactggtg gtggatgatt tccccaccat gcggcgcatc        60
     atacgcaacc tgctcaagga gctgggtttc gagaacgtcg acgaggccga ggacggcgcc       120
     atcgggctgg agaaactgcg caacggcgcc ttccagttcg tggtgtcgga ctggaacatg       180
     ccgaacctcg acggcctgga gatgctcaag cagatccgcg ccgacgcggc gctgaagtcg       240
     ttgccggtgc tgatggtgac ggccgaggcc aagaaggaga acatcgtggc ggcggcccag       300
     gccggcgcca acggctacgt ggtcaaggcg ttcacggccg cgacgctgga agagaagctg       360
     aacaagatct tcgagaaact cgccggctga                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page