(data stored in ACNUC1104 zone)

EMBL: BX640427.PE19

BX640427.PE19        Location/Qualifiers
FT   CDS_pept        complement(17594..18784)
FT                   /transl_table=11
FT                   /locus_tag="BPP1310"
FT                   /product="putative FAD dependent oxidoreductase"
FT                   /note="Similar to Ralstonia solanacearum hypothetical
FT                   transmembrane protein Rsp1590 or Rs02147 SWALL:Q8XPP8
FT                   (EMBL:AL646085) (398 aa) fasta scores: E(): 6.5e-50, 37.72%
FT                   id in 387 aa, and to Rhizobium loti hypothetical protein
FT                   Mll4416 SWALL:Q98E45 (EMBL:AP003004) (388 aa) fasta scores:
FT                   E(): 2e-42, 34.52% id in 391 aa"
FT                   /db_xref="GOA:Q7WAQ9"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAQ9"
FT                   /protein_id="CAE36612.1"
FT                   /translation="MQAMNQPQVQQYDIVIIGGGIIGSSVAYHVLARDPAARVCVVEPD
FT                   PSYEFASALRSSGGCRVQFTCPENIAMSLYSLDVIKNFENTMAANGRPAPVDWVQGGYL
FT                   FLVPPERVAMLERNVARQQAMGCQVDLLTPAELKARFPSIHVDDLGAGAHTPQDGWCDP
FT                   NGLLWGFRRKAVELGAVYLKDRVVAADVTPARARRVTLESGAQLDAEAFVNAAGAWSGQ
FT                   VAELFGMHLPVVPMRRFEHYFTCGNPIEPLPYVKDLSRLAFRSEGRGFSGGLVNGDENR
FT                   GFNFDVDHDYFENVVWPAVAHHFPPLEAAKCHRTWSGLYEQNELDGNPVIGAWNVRLKN
FT                   LYTVAGFSGHGMMHAPAAGRGIAELLVHGAFQSLDLSKLGYERVQASQPYREEGIL"
     gtgcaagcca tgaatcagcc gcaggtccag cagtacgaca tcgtcatcat cggcgggggc        60
     atcatcggct ccagcgtggc ctaccacgtg ctggcgcgcg acccggccgc gcgggtctgc       120
     gtcgtggagc cggatccgag ctacgagttc gcctcggcgc tgcgttcatc gggcggctgc       180
     cgggtgcagt tcacctgccc cgagaacatc gccatgtcgc tctacagcct ggacgtcatc       240
     aagaacttcg agaacaccat ggccgccaat ggccggcccg cgccggtcga ctgggtgcaa       300
     ggcggctacc tgttcctcgt gccgcccgag cgcgtcgcca tgctcgagcg caacgtggcg       360
     cggcagcagg ccatgggctg ccaggtcgac ctgcttaccc ccgccgaact gaaggcgcgc       420
     tttccctcca tccatgtcga cgacctgggc gccggcgcgc atacgccgca agacggctgg       480
     tgcgatccca acggcctgct gtggggcttt cggcgcaagg ccgtcgaact gggcgcggtg       540
     tatctcaagg accgtgtcgt ggccgccgac gtcacgcccg cccgcgcgcg ccgcgtcacg       600
     ctggaaagcg gcgcgcagct ggacgccgaa gccttcgtca acgccgccgg cgcctggtcg       660
     ggccaggtcg ccgagctgtt cggcatgcac ctgccggtcg tgccgatgcg ccgcttcgaa       720
     cactacttca cgtgcggcaa cccgatcgaa cccctgccct acgtgaagga tctcagccgc       780
     ctggcgttcc gctccgaagg ccggggcttt tccggcggcc tggtcaacgg cgacgaaaac       840
     cggggcttca acttcgatgt cgatcacgac tatttcgaga acgtcgtctg gccggccgtg       900
     gcgcatcact tcccgccgct cgaagcggcc aagtgccacc gcacctggtc cggcctgtac       960
     gaacagaacg agctcgacgg caacccggtg atcggtgcct ggaacgtgcg cctgaagaat      1020
     ctgtacacgg tggcgggttt ctccgggcac ggcatgatgc acgcgcccgc cgccggccgc      1080
     ggcatcgccg aactgctggt gcacggcgcg ttccagagcc tcgacctgtc gaagctgggc      1140
     tacgaacgcg tgcaggccag ccagccctac cgcgaagaag gcattctctg a               1191
//

If you have problems or comments...

PBIL Back to PBIL home page