(data stored in ACNUC1104 zone)

EMBL: BX640427.PE191

BX640427.PE191       Location/Qualifiers
FT   CDS_pept        complement(197328..197810)
FT                   /transl_table=11
FT                   /locus_tag="BPP1482"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1370"
FT                   /db_xref="GOA:Q7WAA0"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAA0"
FT                   /protein_id="CAE36784.1"
FT                   /translation="MNSAALKSCLERENALVVEFLHALEAETEALMDRRAHESLQAAVQ
FT                   RKETLADDLAQLGAERDALLSDAGLASGPAGTDAAAAAHPELGPLWQALQANAAQAREH
FT                   NQRNGTLIAVNLRHTQESLDALRQAAGTGAAATYDAQGRGKRGYSSAASGRAIVAT"
     atgaattctg ccgccctgaa gtcctgcctc gaacgcgaaa acgccctggt ggtggagttc        60
     ctccacgccc tggaagcgga aaccgaggcc ctgatggacc gccgcgcgca cgagtcgctg       120
     caggccgcgg tgcagcgcaa ggaaaccctg gccgacgacc tggcgcagct gggcgccgag       180
     cgcgacgccc tgctgagcga cgccggcctg gccagcggtc cggccggcac cgacgcggct       240
     gccgccgccc accctgaact gggcccgctg tggcaggccc tgcaggccaa cgccgcccag       300
     gcgcgcgagc acaaccagcg caacggcacc ctgatcgcgg tgaacctgcg ccatacgcaa       360
     gagtcgctcg acgccctgcg ccaggccgcc ggcaccggcg cggccgccac ctatgacgcc       420
     cagggccgcg gcaagcgcgg ctactccagc gcggcatcgg gccgcgccat cgtcgccacc       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page