(data stored in ACNUC1104 zone)

EMBL: BX640427.PE2

BX640427.PE2         Location/Qualifiers
FT   CDS_pept        734..1345
FT                   /transl_table=11
FT                   /locus_tag="BPP1293"
FT                   /product="putative membrane transport protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP2597"
FT                   /db_xref="GOA:Q7WAS5"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAS5"
FT                   /protein_id="CAE36595.1"
FT                   /translation="MSLLAFLLAAALLAITPGPGIAYVVARTVAGGRAEGLASCLGTAL
FT                   GGLVHVLAAALGLSVLIAESALAFSLLKYAGAAYLVYLGLRMWLSPRPAAVRVVAPQGA
FT                   RRALAEGVLVEALNVKTALFFLAFLPQFVDPGAPLAPQLALLGGICVTLNTLVDVMAVV
FT                   AAHRLLRSEAARVARARVLTRVSGTTMVGLGVFLALARRD"
     atgtccctgc tggcctttct gcttgccgcc gcgctgctgg ccatcacgcc cgggcccggc        60
     atcgcctatg tggtcgcccg cacggtggcc ggcggccgcg ccgaaggact ggcctcgtgc       120
     ctgggcacgg cgctgggcgg cctggtgcac gtgctggcgg cggcgctcgg cctgtcggtg       180
     ctgatcgccg agtcggcgct ggccttcagc ttgctcaagt atgcgggggc cgcctacctg       240
     gtgtacctgg gcctgcgcat gtggctgagc ccgcgcccgg cggcggtgcg cgtcgtggcg       300
     ccgcagggcg cgcggcgcgc gctggccgag ggcgtgttgg tcgaggcgct gaacgtcaag       360
     acggcgttgt tcttcctggc gttcctgccg cagttcgtcg atcccggcgc gccgctggcg       420
     ccgcaactgg cgctgctggg gggcatctgc gttacgctca ataccttggt cgatgtgatg       480
     gcggtggtcg ctgcccatcg actgctgcga tccgaggcgg ctcgcgttgc gcgcgctcgc       540
     gtgctgacgc gcgtgtcggg aaccacgatg gtgggcctgg gcgtctttct ggcgctggcg       600
     cggcgagact ag                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page