(data stored in ACNUC1104 zone)

EMBL: BX640427.PE205

BX640427.PE205       Location/Qualifiers
FT   CDS_pept        210020..211687
FT                   /transl_table=11
FT                   /gene="tsr"
FT                   /gene_synonym="cheD"
FT                   /locus_tag="BPP1496"
FT                   /product="methyl-accepting chemotaxis protein I"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1384"
FT                   /db_xref="GOA:Q7WA87"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA87"
FT                   /protein_id="CAE36798.1"
FT                   /translation="MARAPLEERVFDGKRINMWSNLKVRTCITLVLGLFLVAMLVSNAM
FT                   AWLGMSSSNDKLERVNNAYSNQAVPAYEAYVMLLRARLNMVSSMMDLQEGRLKESADTL
FT                   AHAQRQAGEARERFEAFLAVAKASSGADRVGAVETAFHAYLEVAARQMEAMQNQKLGEF
FT                   VQLNPSAQRLNTAFDTAASAYLDRIDTDTDALVDDARAEHLRANTVTLVLIVLALALCA
FT                   GCGVFIGRAVLRPLKEAGQHFDRIAAGDLTARVDVRSTNEIGQLFAALKRMQESLTRTV
FT                   AAVRRGVDEINVGSREISAGNTDLSSRTEEQAASLEETAASMEQLASTVKQNADNARQA
FT                   NQLAASASDVAERGGSAVSEVVTTMQDISASSRKISEIVSVIDGIAFQTNILALNAAVE
FT                   AARAGEQGKGFAVVAGEVRSLAQRSAQAAKEIKVLIEDSVDKVGTGSQQVERAGATMQE
FT                   IVASVKRVTDIMGEISAASEEQSSGIEQVNRAVSQMDEVTQQNAALVEEAAAAAGSLQE
FT                   QAQRLAEAVAVFKINTGEVIEVPAHQLSGYAAPLVAQS"
     atggcgcgcg ctcccctcga ggagcgcgtg ttcgatggaa agcggataaa catgtggtcg        60
     aatttgaagg tacgcacctg catcaccctg gtgctgggcc tgtttctggt ggcaatgctg       120
     gtgtccaacg caatggcctg gctgggcatg agctcgagca acgacaagct ggagcgcgtc       180
     aataacgcgt attcgaacca ggccgtgccg gcctacgagg cctacgtcat gctgctgcgg       240
     gcgcggctga acatggtctc gtcgatgatg gacctgcagg aagggcggtt gaaggagtcg       300
     gccgatacgc tggcgcacgc gcagcgccag gccggcgaag cgcgcgagcg cttcgaggcc       360
     ttcctggcgg tggccaaggc ttcgtcgggc gccgaccggg tcggcgcggt ggagacggcg       420
     ttccatgcct acctggaggt ggcggcgcgc cagatggagg ccatgcagaa ccagaagctg       480
     ggcgagttcg tgcagctcaa cccgtccgcg cagcgcctga acactgcttt cgatacggcg       540
     gcgtcggcgt acctggaccg gatcgacacg gacaccgacg cgctggtgga cgatgcgcgc       600
     gccgaacacc tgcgcgccaa tacggtaacc ctggtgttga ttgtcctggc gctggcgctg       660
     tgcgccggct gcggggtgtt catcggccgc gccgtgctgc gcccgctcaa ggaagccggc       720
     cagcacttcg acaggatcgc cgcgggcgac ctgaccgcgc gggtggatgt gcgcagcacc       780
     aatgagatcg gccagctgtt cgccgcgctg aagcgcatgc aggagagcct gacgcgtacc       840
     gtcgcggcgg tgcgccgcgg ggtggacgag atcaacgtgg gttcgcgcga gatctcggcc       900
     ggcaacacgg acctgtccag ccgcaccgag gagcaggcgg cctcgctgga ggagaccgcg       960
     gcctcgatgg agcagctggc ctcgacggtc aagcagaatg ccgacaacgc gcgccaggcc      1020
     aatcagctgg cggccagcgc ctcggacgtg gccgagcgcg gcggttcggc ggtgtccgag      1080
     gtggtgacga cgatgcagga catctcggcc agctcgcgca agatttccga gattgtgtcg      1140
     gtgatcgacg ggatcgcgtt ccagaccaac atcctggcgc tgaacgcggc ggtggaagcg      1200
     gcgcgcgcgg gcgagcaggg caagggtttc gcggtggtgg cgggcgaagt gcgctcgctg      1260
     gcgcagcgca gcgcccaggc ggccaaggag atcaaggtgc tgatcgagga ctcggtcgac      1320
     aaggtgggca cgggttcgca gcaggtcgag cgcgccggtg cgacgatgca ggagatcgtg      1380
     gcctcggtca agcgggtgac ggacatcatg ggcgagattt cggcggcctc ggaagagcag      1440
     tccagcggga tcgagcaggt caaccgcgcg gtgtcgcaga tggacgaggt aacgcagcag      1500
     aacgcggcgc tggtggaaga ggcggccgcg gcggccggct cgctgcagga gcaggcgcag      1560
     cgcctggccg aggcggtagc ggtgttcaag atcaataccg gcgaagtgat cgaagtgccg      1620
     gcgcaccaat tgtccggcta cgcggcgccc ctggtcgcgc agtcctga                   1668
//

If you have problems or comments...

PBIL Back to PBIL home page