(data stored in ACNUC1104 zone)

EMBL: BX640427.PE21

BX640427.PE21        Location/Qualifiers
FT   CDS_pept        complement(19706..20359)
FT                   /transl_table=11
FT                   /locus_tag="BPP1312"
FT                   /product="probable GntR-family transcriptional regulator"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   transcriptional regulator Pa1269 SWALL:Q9I475
FT                   (EMBL:AE004556) (222 aa) fasta scores: E(): 6.3e-24, 41.17%
FT                   id in 204 aa, and to Rhizobium loti transcriptional
FT                   regulator Mlr7144 SWALL:Q986Z8 (EMBL:AP003011) (253 aa)
FT                   fasta scores: E(): 1.9e-18, 37.43% id in 203 aa"
FT                   /db_xref="GOA:Q7WAQ7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAQ7"
FT                   /protein_id="CAE36614.1"
FT                   /translation="MTNANAGPLTLTADGVTDELRALILDGSLGIGVQLKQEVLAKRFG
FT                   VSRIPVREALKRLEAEGLVTHAPHQGSVVASRSVQELLETLDIRVGLESRALVLAIPHM
FT                   TPAVFKEAETIIARYDASEFPREWSELNLEFHMCLYRPSGRPRLLKTIENLVRGIDIHL
FT                   RAHQSYAVGRKSPQNEHRAILDACIAGKAKRARDLLEAHIEHTQDVLRKEHGLI"
     atgaccaacg ctaatgcagg acccttgacg ctgaccgccg atggcgtgac cgacgagttg        60
     cgcgccctga tcctcgacgg ctcgctgggc atcggcgtgc agctcaagca ggaggtgctg       120
     gccaagcgct tcggcgtcag ccgcataccg gtgcgcgagg cgctcaagcg gctggaagcc       180
     gagggactgg tcacgcacgc gccgcaccag ggctcggtgg tcgcgtcgcg ctcggtccag       240
     gaactgctgg aaacgctcga catccgggtg gggctggaat cgcgcgcgct ggtgctggcc       300
     attccgcaca tgacgcccgc ggtcttcaag gaagccgaga ccatcatcgc gcgctacgac       360
     gccagcgaat tcccgcgcga atggagcgag ctgaacctcg aattccatat gtgcctgtac       420
     cgccccagcg gccgcccgcg cctgctcaag accatcgaga acctggtgcg cggcatcgat       480
     atccatctgc gtgcgcacca gtcctatgcc gtgggccgca agtcgcccca gaacgagcac       540
     cgcgccatcc tggacgcatg catcgccggc aaggccaagc gcgcgcgcga cctgctcgaa       600
     gcgcacatcg agcacacgca ggacgtgctg cgcaaggaac atggcctgat ctga             654
//

If you have problems or comments...

PBIL Back to PBIL home page