(data stored in ACNUC1104 zone)

EMBL: BX640427.PE22

BX640427.PE22        Location/Qualifiers
FT   CDS_pept        20580..21056
FT                   /transl_table=11
FT                   /locus_tag="BPP1313"
FT                   /product="putative phage-related protein"
FT                   /note="Similar to Bacteriophage T4 hypothetical 17.1 kDa
FT                   protein in gp30-riiI intergenic region Y12g or 30.3
FT                   SWALL:Y12G_BPT4 (SWALL:P32276) (152 aa) fasta scores: E():
FT                   6.3e-07, 32.66% id in 150 aa, and to Bacteriophage RB69
FT                   Gp30.3 30.3 SWALL:CAD28421 (EMBL:AJ439452) (137 aa) fasta
FT                   scores: E(): 5.1e-06, 33.62% id in 113 aa"
FT                   /db_xref="InterPro:IPR012596"
FT                   /db_xref="InterPro:IPR012816"
FT                   /db_xref="InterPro:IPR037238"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WAQ6"
FT                   /protein_id="CAE36615.1"
FT                   /translation="MNSASRLNISSTSDDWRGLALSNFPLSPFVLDGELFASVEGFIQG
FT                   IKFREDDPRRATAFLSSGWDAKHLGDTVDRSGAYWGGARIRYGSAEHHQLIERAIRARI
FT                   KQCEGLRRTLRATEGMTLVHDTGKPEAPHTSLPATVFCRILETLRREILARARP"
     atgaactccg catctcgcct gaacatctcc agtacgtccg acgattggcg cggcctggcg        60
     ctgtcgaatt tccccctgtc gccgttcgtg ctcgatggcg agctgttcgc ctcggtggaa       120
     gggttcatcc aggggatcaa gttccgcgag gacgatccgc gccgcgccac tgcgttcctg       180
     tccagcggct gggatgccaa gcacctgggc gacacggtgg accgcagcgg ggcctattgg       240
     ggcggcgcgc gcattcggta cggctcggcc gaacaccacc agttgatcga gcgggccatc       300
     cgcgcccgca tcaagcaatg cgagggcttg cgtcgcacct tgcgggcgac cgagggcatg       360
     accctggtgc acgataccgg caagccggag gccccgcata cctcgctgcc cgccacggtg       420
     ttctgccgca ttctcgaaac gctgcgccgg gaaattctgg cgcgcgcgcg gccgtag          477
//

If you have problems or comments...

PBIL Back to PBIL home page