(data stored in ACNUC1104 zone)

EMBL: BX640427.PE221

BX640427.PE221       Location/Qualifiers
FT   CDS_pept        complement(225412..225807)
FT                   /transl_table=11
FT                   /locus_tag="BPP1512"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1405"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA75"
FT                   /protein_id="CAE36814.1"
FT                   /translation="MTAQDQIVVLTQSDQIRSTLQELRHPDCQIVISGIDQRPWPVRIL
FT                   GPDAKDGYFFWRPLDLACPDSVMLARMADEDEPPLAFHAQTADGARIHFCVDSPVTLRF
FT                   GDGSIAVLSLFPSAVRHTCARPPQAPA"
     atgacggccc aggaccagat cgtcgttctg acccagtccg atcagatacg cagcacgctg        60
     caggaactgc gccaccccga ttgccagatc gtgatttccg gcatcgacca gcgcccctgg       120
     ccggtgcgca tcctggggcc ggatgccaag gacgggtatt ttttctggcg cccgctcgac       180
     ctggcctgcc ccgactccgt catgctggcg cgcatggccg acgaggacga accgccgctg       240
     gcctttcacg cccagacggc cgacggggcg cgcatccatt tctgcgtgga cagtccggtc       300
     acgctgcgct ttggcgacgg cagcatcgcc gtgctttcgc tgtttcccag cgcggtgcgc       360
     cacacctgcg cccgcccgcc ccaggcgccg gcctga                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page