(data stored in ACNUC1104 zone)

EMBL: BX640427.PE222

BX640427.PE222       Location/Qualifiers
FT   CDS_pept        complement(225817..226131)
FT                   /transl_table=11
FT                   /locus_tag="BPP1513"
FT                   /product="conserved hypothetical protein"
FT                   /product="putative flagellar protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1406"
FT                   /db_xref="GOA:Q7WA74"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA74"
FT                   /protein_id="CAE36815.1"
FT                   /translation="MNTPAPPAADDASRPVAVALSYDGGEAAPRVVAKGYGQLADTIVR
FT                   TAREHGLHVHESRELVGLLMQVDLDAHIPPQLYTAVAELLAWLYRLEARELPEVLAPQA
FT                   "
     atgaatacgc ccgccccgcc cgccgccgac gacgccagcc gcccggtcgc cgtggcgctg        60
     tcctatgacg gcggcgaagc ggccccgcgt gtggtcgcca agggctacgg ccagctggcc       120
     gacaccatcg tgcgcaccgc ccgcgaacac ggcctgcatg tacatgaatc gcgcgaactg       180
     gtcggcctgc tgatgcaggt ggacctggac gcccatatac cgccgcaact ctacacggcg       240
     gtggccgagc tgctggcctg gctatatcgg ctcgaagcgc gcgagctgcc cgaagtgctg       300
     gcgccgcagg cctga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page