(data stored in ACNUC1104 zone)

EMBL: BX640427.PE223

BX640427.PE223       Location/Qualifiers
FT   CDS_pept        complement(226128..227399)
FT                   /transl_table=11
FT                   /locus_tag="BPP1514"
FT                   /product="hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1407"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA73"
FT                   /protein_id="CAE36816.1"
FT                   /translation="MSVGPPALGSILVQRLDAVLGTTMSAQSNLVSGARPDAVAQPGEA
FT                   ARPGASQTATRDPRQAVQTGGERGARQGAAGVDAKTAAALALAARGLQTSTGTTASAPT
FT                   TLGQTARTILALLAQYPGQAPAVSARAPLWTPPAQDGASPPAGGQPAAAAPNAPAQASA
FT                   AAGGAASTPSRPEAAQAGAASARTPAQTPPATLAALAGRAVLPAAPALAQALRQTLQAS
FT                   GLFYESHLSDLAFGKRSVQQLQAEPQARLPAAGAEPAATPRAPENATPARALPAAEAAP
FT                   PGQPATHTPGAPVPGIHQDATLLVRQQLDVLANQMLAWQGQAWPGTPMEWEVAREHGDD
FT                   AAGQPGTHWATRLKLNLPRLGTVEARLNLAANQLVLHVVAPDSAAEIGAAADALRQQLS
FT                   AAGLTLTNLSVDAIGAPGFDLPEA"
     atgagtgtcg gcccgcccgc cctgggcagc attctggtgc agcggctcga cgccgtactg        60
     ggcaccacga tgtcggcgca atccaacctg gtatccggcg cacgccccga cgcggtcgcc       120
     caacccggcg aggccgcccg ccccggcgca tcccagacag ccacgcgcga tccgcgccag       180
     gcggtacaga ccggcggcga gcgcggcgcg cgccagggcg ccgcgggggt ggacgccaag       240
     accgcggccg cgctggcgct ggccgcccgc ggcctgcaga ccagcaccgg cacgacggcc       300
     tccgcaccga ccacgctggg ccagaccgcg cgcaccattc tcgccctgct ggcgcagtat       360
     cccggccagg cgccggcggt aagcgcccgc gcgccgctgt ggacgccgcc ggcccaggat       420
     ggcgccagcc cgcccgccgg cggccagcct gccgcggccg cccccaacgc gcctgcccag       480
     gccagcgccg cggccggcgg cgccgcgagt acgccctccc gcccggaagc ggcgcaggcc       540
     ggcgcggcga gcgccaggac gcccgcgcag acgccgcccg ccacgctcgc cgccctggcg       600
     ggccgggccg tgctgccggc cgcgccggca ctggcccagg cattgcgcca gacgctgcag       660
     gccagcggcc tgttctatga atcccacctg agcgacctgg ccttcggcaa gcgcagcgtg       720
     cagcagttgc aggccgaacc gcaggcgcgg ctgcccgccg ccggcgccga gccggccgcc       780
     acgccacgcg cgcccgaaaa cgcgacgccg gcgcgcgccc tgcccgcggc cgaagccgcg       840
     ccgccaggcc agcccgccac gcatacgccc ggcgcgccgg tgcccggcat tcaccaggac       900
     gccacgctgc tggtgcgcca acagctggat gtgctggcca atcagatgct cgcatggcag       960
     gggcaggcct ggcccggcac acccatggaa tgggaggtcg cgcgcgagca tggcgatgac      1020
     gcggccggcc agcccggcac ccactgggcc acccgcctga aactcaacct gccgcgcctg      1080
     ggcacggtcg aggcgcgcct gaacctggcg gccaaccagc tggtgctgca cgtcgtggcc      1140
     ccggacagcg ccgccgagat cggcgccgcc gccgacgcgc tgcgccagca actgtcggcc      1200
     gccggcctga cgcttaccaa tctgtcggtc gacgcgattg gcgcgcccgg ctttgatctg      1260
     cccgaagcat ga                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page