(data stored in ACNUC1104 zone)

EMBL: BX640427.PE227

BX640427.PE227       Location/Qualifiers
FT   CDS_pept        complement(229744..230106)
FT                   /transl_table=11
FT                   /locus_tag="BPP1518"
FT                   /product="putative flagellar protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1411"
FT                   /db_xref="InterPro:IPR005186"
FT                   /db_xref="InterPro:IPR035924"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA69"
FT                   /protein_id="CAE36820.1"
FT                   /translation="MAVSPINAAAPALVSAAPAPVPAQPAAAAAANGGGAQSATQDQYG
FT                   APKLPMDRALEEINAQLKAWSTQLQFEIDPDVHQVVVSIVDAETGDVLRTIPSEAVIRI
FT                   AKMIVKMQGNAVETTA"
     atggccgtaa gccctatcaa cgccgcggcg cccgcgctgg tttccgccgc gcccgcccct        60
     gtccccgcac agccggcggc cgccgcggcc gccaacggcg gcggcgccca atccgccacg       120
     caggaccagt acggcgcgcc caagctgccg atggaccggg cgctggagga aatcaatgcg       180
     cagttgaagg cctggtccac gcagctgcag ttcgagatcg acccggacgt gcaccaggtg       240
     gtggtctcga tcgtggacgc cgaaacgggg gatgtgctgc gcaccattcc gtccgaggcg       300
     gtgatacgca tcgccaagat gatcgtcaag atgcagggca atgccgtcga gaccacggcc       360
     tga                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page