(data stored in ACNUC1104 zone)

EMBL: BX640427.PE229

BX640427.PE229       Location/Qualifiers
FT   CDS_pept        231964..232794
FT                   /transl_table=11
FT                   /locus_tag="BPP1520"
FT                   /product="conserved hypothetical protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1413"
FT                   /db_xref="GOA:Q7WA67"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA67"
FT                   /protein_id="CAE36822.1"
FT                   /translation="MGLFTSKDSASETQSSRPRPSVSSEAQAAELRARARRRLAGAVAL
FT                   VLAAVIVLPMILDSEPVPVDSDIPIRVPDRNSAFQPTVNDPQAAAPQPEQPAPQAPAGT
FT                   PEAGAPQPPALASAPPQTPPPGQTPAQPQTPPAAQPPATPPQQAATPPAAPKPEAKPEP
FT                   KPAKPAAPARSDDGARAIALLEGRSPPPAQPKPAANGNFVLQVASYTTQADAQARRGKL
FT                   HQAGVTNAFVEQASINGKQQYRLRVGPFPSREAAQAAQARLRTLGYDNGFIAAQ"
     atgggattgt tcactagcaa agattcggcc tccgagacgc agtcctcgcg accgcgtcca        60
     tccgtatcca gcgaggcgca ggccgccgag ctgcgggccc gggccaggcg ccgcctggca       120
     ggcgccgtcg cattggtgct cgccgcggtc atcgtcctgc ccatgatcct cgactccgag       180
     cccgtgccgg tcgacagcga catccccatc cgcgtcccgg accgcaattc ggccttccag       240
     cccacggtca acgatccgca ggccgccgcg ccgcagccgg aacagcccgc gccgcaggcg       300
     ccggccggca cgcccgaggc gggcgcgccg cagccgcccg cgctggcgtc cgcgccgccg       360
     cagacgccgc ctccgggcca gacgccggcc cagccccaga cgccgcccgc ggcccagccg       420
     ccggccacgc cgccgcagca ggccgccacg ccgccggccg cgcccaagcc cgaggccaag       480
     ccggaaccca agcccgccaa gccggcggcg ccggcgcgct cggacgacgg cgcgcgcgcg       540
     atagcgctgc tggaggggcg ttcgccgccg ccggcgcagc ccaagccggc cgccaacggc       600
     aatttcgtgc tgcaggtggc ttcctatacc acgcaggccg atgcgcaggc gcgccgcggc       660
     aagctgcacc aggccggcgt caccaatgca ttcgtcgagc aggcctcgat caacggcaag       720
     caacagtatc gactgcgcgt ggggccgttc ccctcgcgcg aggcggccca ggcggcgcag       780
     gcgcgcctgc gcacgctggg ctatgacaac ggtttcatcg ccgcacagtg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page