(data stored in ACNUC1104 zone)

EMBL: BX640427.PE243

BX640427.PE243       Location/Qualifiers
FT   CDS_pept        246578..247912
FT                   /transl_table=11
FT                   /locus_tag="BPP1534"
FT                   /product="putative membrane protein"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1426"
FT                   /db_xref="GOA:Q7WA53"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA53"
FT                   /protein_id="CAE36836.1"
FT                   /translation="MLFTLLAFVVALGTLITFHELGHYWIARLCGVRVLRFSVGFGRVL
FT                   ARRTDRHGTEWAISAIPLGGYVKMQDDPPAGASAAEAARSFNAQPVGRRIAIVAAGPLF
FT                   NLFLAVVLYAGLNLAGTEVPAPVVGQPAAGTPAAQAGLMAGDRIEAVQGRAVDSWNDAR
FT                   WRLLDVLSSQGEAQLEVRGPGGAARGLVLQVPGGNRLDPADGDPLAETGLRLAQPKPVV
FT                   REVIAGGAGEQAGLRGGDLIVAAGQAADLDAGALVALIQRHAGQPLALTVQRGADRLTL
FT                   TVVPRAESVQGQEVGRIGVQLGGDIPMVTVRYGVIDSVWRGAQRTWDTAWLSLRMMGRM
FT                   VLGEVSWRNISGPVTIADYAGQTARIGLEAYIAYLALISISLGVLNLLPIPMLDGGHLL
FT                   YYLVEIVKGSPVSDRWIDIGQRAGIGLLAGLMGLALFNDFARLFT"
     atgcttttca cgctgctggc ctttgtcgtc gccctgggca ccctaattac gttccatgaa        60
     ctgggccact actggatcgc ccggctgtgc ggcgtgcgcg tgctgcgttt ttccgtcggg       120
     ttcggccggg tgctggcgcg ccgcaccgac cgccacggca ccgagtgggc catttccgcg       180
     atccccctgg gcggctacgt caagatgcag gacgatccgc cggcaggcgc cagcgcggcc       240
     gaggcggcgc gctccttcaa tgcccagccg gtcgggcgcc gcatcgccat cgtggccgct       300
     gggccgctgt tcaatctttt tctcgccgtg gtcctgtatg ccggcctgaa cctggccggc       360
     accgaagtgc ccgcgccggt ggtgggccag ccggcggccg gcacgccggc cgcgcaggcc       420
     ggcctgatgg ccggcgaccg catcgaggcg gtgcaggggc gcgcggtcga ttcctggaat       480
     gacgcgcgct ggcgcctgct ggacgtgctt tccagccagg gcgaggcgca gctggaagtg       540
     cgcggccccg gcggcgcggc gcgcggtctc gtgctgcagg tgccgggcgg caaccgcctg       600
     gatccggccg acggcgaccc gctggccgag accggcctgc gcctggccca gcccaagccg       660
     gtggtgcgcg aggtcatcgc cggcggcgcc ggcgagcagg ccggcctgcg tggcggcgac       720
     ctgatcgtgg cggccggcca ggccgccgac ctggacgcgg gcgcgctggt ggccctgatc       780
     cagcgccatg ccggccagcc cctggccctg acggtgcagc gcggcgccga ccgcctgacc       840
     ctgacggtgg tgccgcgggc cgaatccgtg cagggccagg aggtgggccg catcggcgtg       900
     cagctgggcg gggatatccc catggtcacg gtgcgctacg gggtgatcga cagcgtctgg       960
     cgcggcgccc agcgcacctg ggacacggcc tggctgtcgt tgcgcatgat gggccgcatg      1020
     gtgctggggg aggtctcctg gcgcaatatc agcggcccgg tcacgatcgc cgattatgcc      1080
     ggccagaccg cccggatcgg cctggaagcc tatattgcct acctggcgct gatcagtatc      1140
     agcctgggcg tattgaacct gctgccgata cccatgttgg acggagggca tctgctgtac      1200
     tatctcgtcg aaattgtaaa aggcagtccc gtttccgatc gctggataga catcggccag      1260
     cgagccggca tcggcctgct cgcaggattg atgggcttgg cactgttcaa tgattttgcg      1320
     cgcctgttca cttag                                                       1335
//

If you have problems or comments...

PBIL Back to PBIL home page