(data stored in ACNUC1104 zone)

EMBL: BX640427.PE244

BX640427.PE244       Location/Qualifiers
FT   CDS_pept        247965..250301
FT                   /transl_table=11
FT                   /locus_tag="BPP1535"
FT                   /product="probable surface antigen"
FT                   /note="ortholog of Bordetella pertussis (BX470248) BP1427"
FT                   /db_xref="GOA:Q7WA52"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:Q7WA52"
FT                   /protein_id="CAE36837.1"
FT                   /translation="MSLRRMFHHKKGVIPGLLAAALLAPALAHAFEPFVVRDIRVEGIQ
FT                   RTDAGTVFGYLPVKVGEKFTDEEATEAVRRLYGTGFFSDVQIQTDNNVVVVVVQERPTI
FT                   ASISFNGMREFDSKAITKSLAQVGFGEGRIFDQSMLERAEYELKEQYLAKGKYGVEVTA
FT                   TVTPLPRNRVGVSFDVFEGEVAKIREIRVVGSKAFSEGELLDQFDLTTPGWLTWYTNTD
FT                   KYSREKLEGDIERLRSFYLDQGYLEFTVEPPQVTISPDRKDIYITITVHEGEPYKVREV
FT                   KLAGNLMGLDSEINNLVEIKSGEVFSAAKANNSAKAITDYLGDLGYAFANVNPNPQLDR
FT                   AKHEADVTFYVDPSRRVYVRRIQIGGNTRTRDEVVRREMRQQEAAWYDAGDIKVSRDRV
FT                   DRLGYFNEVNVKTDPVPGSPDQVDVNVDVKEKPTGIINLGVGYGSSEKAILSAGISEDN
FT                   VFGSGTNLTLQLNTSKTNRAVVLSHTDPYFTKDGISRTTSAYYRVTEPWDNNDGDYRVK
FT                   AMGLGMNFGVPISEYDRIFLGGTFERNQIDLYNNSPQAYRDFVDQYGDSTNALIFNTGW
FT                   SKDTRDSALAPTKGAYTRLKGDFSTMDLKYYLLTAQQQYYLPLGRSYTLALNGMIDYGR
FT                   SYGGLDYPVIKNVYAGGIGTVRGYEGASLGPRDRLTGDYIGGSRRMVANAQLYLPFPGA
FT                   SKDRTLRWFVFTDAGQVAAGSGMSCTAGKPGSEVEDPCGWRFSAGIGLSWQSPLGPLQL
FT                   SYARPLNSKSGDDTQAFQFQIGTGF"
     atgtctctac gccggatgtt tcatcacaaa aagggcgtta taccgggttt gttagccgcc        60
     gcgcttcttg cgcccgcgct ggcccatgcc ttcgagccct ttgtcgtgcg ggatatccgc       120
     gtggagggca ttcagcgtac cgacgccggc acggtgttcg gctacctgcc ggtcaaggtc       180
     ggcgagaagt tcaccgacga ggaggccacc gaggcggtgc gccgcctgta cggcacgggc       240
     tttttcagcg acgtgcagat ccagaccgac aacaacgtcg tcgtggtcgt ggtgcaggag       300
     cgccccacga tcgcctcgat cagtttcaat ggcatgcgcg agttcgactc caaggccatc       360
     accaagtcgc tggctcaggt gggtttcggc gaagggcgca tcttcgacca gtccatgctc       420
     gaacgcgccg agtacgagct gaaagaacag tacctggcca agggcaagta cggcgtcgaa       480
     gtcaccgcga cggtcacgcc gctgccgcgc aaccgggtgg gcgtcagttt cgacgtgttc       540
     gaaggcgaag tggccaagat ccgcgaaatc cgcgtggtcg gcagcaaggc tttctcggaa       600
     ggcgagctgc tcgaccagtt cgacctgacc acgccgggct ggctgacctg gtacaccaac       660
     accgacaagt actcgcgcga gaagctggaa ggcgacatcg agcggctgcg ctcgttctac       720
     ctggaccagg gctacctgga gttcacggtc gagccgcccc aggtcaccat ctcgcccgac       780
     cgcaaggaca tctacatcac catcaccgtg cacgagggcg agccctacaa ggtgcgcgaa       840
     gtgaagctgg ccggcaacct gatggggctg gacagcgaaa tcaacaacct ggtcgagatc       900
     aagtcgggcg aggtattctc cgccgccaag gccaacaact cggccaaggc cattaccgac       960
     tacctgggcg acctgggcta cgcattcgcc aacgtcaacc ccaacccgca gctcgaccgc      1020
     gccaagcacg aggccgacgt cacgttctac gtcgacccga gccgccgcgt ctacgtgcgc      1080
     cgcatccaga tcggcggcaa cacgcgcacc cgcgacgaag tggtgcggcg cgaaatgcgc      1140
     cagcaggaag ccgcctggta cgacgcgggc gacatcaagg tgtcgcgcga ccgcgtcgac      1200
     cgcctgggct atttcaacga ggtcaacgtc aagaccgatc cggtgccggg ctcgcccgac      1260
     caggtcgacg tcaacgtgga cgtcaaggaa aagcccaccg gcatcatcaa cctgggcgtg      1320
     ggctacggtt cgtccgaaaa ggcgattctg tcggccggta tcagcgaaga caacgtcttc      1380
     ggcagcggca ccaacctgac gctgcagttg aataccagca agaccaaccg cgccgtggtg      1440
     ctttcgcaca ccgatccgta tttcaccaag gacggcatca gccgcaccac ctcggcgtac      1500
     taccgcgtca ccgagccgtg ggacaacaac gacggcgact accgcgtgaa ggccatgggc      1560
     ctgggcatga acttcggcgt gcccatctcc gagtacgacc ggatcttcct gggcggcacg      1620
     ttcgagcgca accagatcga tctgtacaac aactcgccgc aggcctatcg cgacttcgtc      1680
     gaccagtacg gcgattcgac caacgcgctg atcttcaaca ccggctggtc caaggacacg      1740
     cgcgacagcg cgctggcgcc gaccaagggc gcgtacacgc gcctgaaggg cgacttctcc      1800
     acgatggatc tgaagtacta cctgctgacg gcgcagcagc agtactacct gccgctgggc      1860
     cgcagctaca cgctggccct gaacggcatg atcgactacg gccgcagcta cggcggcctg      1920
     gactacccgg tgatcaagaa cgtgtacgcc ggcggcatcg gcacggtgcg cggctacgag      1980
     ggcgcctcgc tgggcccgcg cgaccgcctc acgggcgact acatcggcgg ttcgcgccgc      2040
     atggtggcca acgcccagct gtacctgccg ttcccgggcg cctcgaagga ccgcacgctg      2100
     cgctggttcg tgttcaccga tgcgggccag gtcgcggccg gcagcggcat gtcgtgcacg      2160
     gccggcaagc cgggcagcga agtggaggat ccgtgcggct ggcgcttctc ggccggtatc      2220
     ggcctgtcgt ggcagtcgcc gctgggtccg ctgcagttgt cgtacgctcg cccgctgaat      2280
     tcgaagtccg gcgacgacac gcaggcgttc cagttccaga tcggcacggg tttctga         2337
//

If you have problems or comments...

PBIL Back to PBIL home page